KEGG   Acidiphilium cryptum: Acry_2821Help
Entry
Acry_2821         CDS       T00527                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acr  Acidiphilium cryptum
Pathway
acr00010  Glycolysis / Gluconeogenesis
acr00020  Citrate cycle (TCA cycle)
acr00620  Pyruvate metabolism
acr01100  Metabolic pathways
acr01110  Biosynthesis of secondary metabolites
acr01120  Microbial metabolism in diverse environments
acr01130  Biosynthesis of antibiotics
acr01200  Carbon metabolism
Module
acr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acry_2821
   00020 Citrate cycle (TCA cycle)
    Acry_2821
   00620 Pyruvate metabolism
    Acry_2821
Enzymes [BR:acr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Acry_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABQ32011
UniProt: A5G2C9
Position
3088054..3089331
Genome map
AA seq 425 aa AA seqDB search
MATNILMPALSPTMTEGTLARWLKKEGETIKAGDVIAEIETDKATMEVEAVDEGVLGKIL
VAAGSENVAVNAPIAILVEPGEAVPDSAPAAPAPKPAAAPEPVAAPAPAAAAPAAETTGH
GPRVFASPLARRMAQQAGIDLATLKGSGPNGRIVKADIDAARGSGPEAAAPAPKAPAAAP
PAQAAAAPAAPITAPHDAIPHSSMRKVIAKRLQAAKQTIPHFYLSMDVELDALLKLRAEL
NAQSPKEGPGAFKLSVNDLIIKAVAVALRRVPAANASFTEEAMIRYHDVDISVAVAIPDG
LITPIIRKADQKGLAAISNEMKDLAARAKAGKLKPDEFQGGSFSISNLGMYGISSFSAII
NPPQGGILAIGAGEKRPVVKGEQIAIATMMTVTLSCDHRVVDGAVGAEFLAAFKSIVERP
LGLML
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaacatcctgatgccagcactctcgcccaccatgacggaaggcacgctggcg
cgctggctcaagaaggaaggcgagacgatcaaggccggcgacgtcatcgccgagatcgag
accgacaaggcgacgatggaggtcgaggcggtcgacgagggcgttctcggcaagatcctg
gtcgctgccggatcggagaatgtcgcggtgaacgcgccgatcgccattctcgtcgaaccg
ggcgaagccgtgccggacagcgcgcccgctgccccggcgccaaagcccgccgccgcgccg
gaaccggtggcggcacctgccccggctgcggcagcgccggcggcggagacgaccgggcat
ggcccgcgcgtcttcgcttcgccgctcgcccgccgcatggcgcagcaggcggggatcgac
ctcgccacgctcaagggctccggcccgaacgggcggatcgtcaaggcggatatcgacgcc
gcccgcggcagtggcccggaagccgcggcaccggcgccgaaagcgccagctgccgcccca
ccggcgcaagccgccgcggccccggccgcgccgatcaccgcgccgcatgacgcgatcccg
cattcctcgatgcgcaaggtgatcgcgaagcggttgcaggccgcgaaacagaccattccg
catttctatctgtcgatggatgtcgagctcgacgcgctgctcaagctgcgcgccgagctg
aacgcgcaatcccccaaggaggggccgggcgcgttcaagctttcggtcaacgacctgatc
atcaaggcggtcgccgtcgccctgcgccgcgttccggcggccaacgcctcgttcaccgag
gaggcgatgatccgctatcacgacgtggacatctcggtggccgtcgcgattccggacggg
ctgatcacgccgatcatccgcaaggcggaccagaaaggcctggccgcgatcagcaacgag
atgaaggacctcgccgcgcgggcaaaggccggcaagctgaagccggacgaattccagggc
ggatcgttctcgatctccaatctcggcatgtatggcatcagctcgttctcggcgatcatc
aacccgccgcagggcggcattctcgccatcggcgccggcgagaagcggcccgtggtgaag
ggtgagcagatcgccatcgccacgatgatgaccgtcaccctgtcctgcgaccatcgcgtg
gtggatggcgcggtcggcgccgaattcctcgcggcgttcaagtccatcgtcgaacggccg
ctggggctgatgctttga

DBGET integrated database retrieval system