KEGG   Acidiphilium cryptum: Acry_2976Help
Entry
Acry_2976         CDS       T00527                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
acr  Acidiphilium cryptum
Pathway
acr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:acr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Acry_2976
Enzymes [BR:acr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Acry_2976
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Acry_2976
    1.1.1.-  
     Acry_2976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABQ32166
UniProt: A5G2T4
Position
3257787..3258863
Genome map
AA seq 358 aa AA seqDB search
MKALRFHAARDLRIEDVAAPDRKPPPGQVLVRNRFVGICGTDLHEYAYGPIFIPTTPHPF
TGAQGPQILGHEFGGVVTAIGEGVSSVKPGDRVSVQPLIMPRAGDYYADRGLFHLSPQLA
LAGLSWAWGGMAEEAMLHEYNVQRIPDALSDEEAALVEPAAVAVYSCDRGGVGAGSAVLV
TGAGPIGLLTLLAARAAGATTLFLSDINDARLAFARSILPDIVVLNPQRDDVGSRVRAAT
EGGAGCDVALECVGNEHALKACLDAVRKQGVVVQTGLHPHDNPLDWFQVTFKDVDLRGAW
AYPTHYWPRVIRMIASGILPASKIVTARIRLDDAVAEGFEALLDPSGRHIKILIDLAA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcactacgattccatgccgcccgcgatctgcggatcgaggacgtcgccgcacct
gaccgcaagccgccgcccggtcaggtcctcgtgcgcaaccgcttcgtcggcatctgcggc
accgacctgcacgaatacgcctacgggccgatcttcatccccaccacaccgcatcccttc
accggcgcccaggggccgcaaatcctcgggcacgaattcggcggtgtcgtcaccgcgatc
ggcgagggcgtctccagcgtgaagccgggcgaccgcgtctccgtccagcccctgatcatg
ccgcgcgccggcgactattatgccgaccgtggcctgtttcacctcagcccgcagctggcg
ctggccggcctcagctgggcctggggcggcatggccgaggaagcgatgctgcacgaatac
aacgtgcagaggattcccgacgcgctgagcgacgaggaagccgccctggtcgagcccgcc
gccgtcgccgtctattcctgcgaccgcggcggcgtcggcgcgggcagcgcggtgctggtg
acgggcgccgggccgatcggcctgctcaccctgctcgccgcccgcgccgccggcgcgacg
acgctcttcctctccgacatcaacgacgcgcggctcgccttcgcccgcagcatccttccc
gacatcgtcgttctcaacccgcagcgcgacgatgtcggctcccgcgtccgtgcggcgacc
gagggcggggcgggctgcgacgtcgccctcgaatgcgtcgggaacgagcacgcgctgaaa
gcctgcctcgatgcggtgcgcaagcagggcgtggtggtccagaccgggcttcacccgcac
gacaatccgctcgactggtttcaggtcacgttcaaggatgtcgacctgcggggcgcctgg
gcctacccgacccattactggccgcgcgtgatccgcatgatcgcgagcggcatcctgccc
gcctcgaagatcgtcaccgcccgcatccggctcgacgatgccgttgccgaagggttcgag
gcgctgctcgatccctccggcaggcacatcaagattctcatcgatctcgccgcctga

DBGET integrated database retrieval system