KEGG   Acidiphilium cryptum: Acry_3073
Entry
Acry_3073         CDS       T00527                                 

Definition
(GenBank) uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
acr  Acidiphilium cryptum
Brite
KEGG Orthology (KO) [BR:acr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acr02044]
    Acry_3073
Secretion system [BR:acr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Acry_3073
SSDB
Motif
Pfam: T6SS_VipA DUF4349 DUF4142 FliT
Other DBs
NCBI-ProteinID: ABQ32261
UniProt: A5G329
Position
complement(3355813..3356319)
AA seq 168 aa
MSGSIHEKLNRVRKPRVHITYDVETDGAQIARELPFVMGVMGDFSGDPTQPLKPLSERKF
VQIDRDNFNDVMARMAPGLKLKVDNTLADDGTQMAVDLKFNSIEDFDPERVVEQVPALKS
LLETRNKLRDLMSKADRSEELESLLEQVLQNEAELKSLSGELGLGKEG
NT seq 507 nt   +upstreamnt  +downstreamnt
atgagtggcagtatccacgagaaactcaaccgcgtacggaagccgcgcgtgcacattacc
tacgatgtcgaaaccgacggcgcgcagatcgcacgcgaactgccattcgtgatgggcgtg
atgggcgatttctccggcgacccgacgcagccgctgaagccgctgtcggagcggaaattc
gtccagatcgaccgcgacaacttcaacgatgtcatggcccgcatggcgcccggcctgaag
ctgaaggtggacaacaccctggccgatgacggcacgcagatggcggttgacctgaaattc
aacagcatcgaggatttcgatcccgagcgtgtcgtcgagcaggttcctgccctcaaatcc
ttgctggagacgcgcaacaagctgcgcgacctgatgagcaaggccgatcgatcggaagaa
cttgagtcgctgcttgaacaggttcttcagaatgaagccgaactgaaatcgctctcgggc
gaactcggcctcggcaaggagggctga

DBGET integrated database retrieval system