KEGG   Acidiphilium cryptum: Acry_3522
Entry
Acry_3522         CDS       T00527                                 

Definition
(GenBank) type IV secretory pathway, VirB3 family protein
  KO
K03198  type IV secretion system protein VirB3
Organism
acr  Acidiphilium cryptum
Pathway
acr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Acry_3522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acr02044]
    Acry_3522
Secretion system [BR:acr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Acry_3522
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABQ29122
UniProt: A5FU40
Position
pACRY03:53016..53348
AA seq 110 aa
MTERQRDPLFVAATRPALFLGLPIEMAVVIIMIAAMIVIFGHNPFYLTLVLPLWFGARCL
VRYDYNAPRVAWLWFRTKATGAGENQAWGGASPAPFPMKVQQGRGMRDAG
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaccgagcggcagcgcgatccgctatttgtcgccgcgacaaggcccgcgctgtttctc
gggctgccgatcgagatggccgtggtgatcatcatgatcgccgccatgatcgtcatcttt
ggacacaaccccttttatctgacgctggtgctgccgctctggttcggggcgcgctgtctc
gttcgatacgactacaacgctccccgtgtggcctggctgtggttccgcaccaaggccacc
ggcgccggtgaaaatcaggcttggggcggggcgtcccccgcgccgttcccgatgaaggtc
cagcagggcagggggatgcgcgatgccggttaa

DBGET integrated database retrieval system