KEGG   Acidovorax sp. RAC01: BSY15_1085Help
Entry
BSY15_1085        CDS       T04481                                 

Gene name
apaG
Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
acra  Acidovorax sp. RAC01
Brite
KEGG Orthology (KO) [BR:acra00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSY15_1085 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOG24664
UniProt: A0A1B3PPG8
Position
1199600..1200046
Genome map
AA seq 148 aa AA seqDB search
MRTRSAATVTIRDMPKNQFDVQVVPEYLPDQSSPDTGVFSFAYTITITNAGDGPAQLISR
HWVISDSHGHTEEVKGLGVVGHQPLLKPGESFQYTSGCRLRTASGTMHGTFHCVTEEGVP
FAAPVALFVLEALSHGPSGKPITGRVLH
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacccgcagtgccgccacggttaccattcgagacatgcccaagaaccagttcgac
gtgcaggttgtgcctgaatacctgcccgaccagtcgtcccccgacaccggggttttcagc
ttcgcgtacaccatcaccatcaccaatgccggcgatgggcccgcccagctgatctcgcgc
cactgggtcatcagcgactcgcacggacacaccgaagaggtcaagggcctgggtgtggtg
ggccaccagccgctgctcaagccaggtgaatcctttcagtacaccagcgggtgccggctg
cgcactgccagcggcaccatgcatggcaccttccactgcgtgaccgaggaaggcgtgccg
tttgccgcccctgtggccctgtttgtgctcgaagccctgagccacgggccctcgggcaaa
cccatcaccggccgggtgctgcattga

DBGET integrated database retrieval system