KEGG   Acidovorax sp. RAC01: BSY15_2091Help
Entry
BSY15_2091        CDS       T04481                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00071  Fatty acid degradation
acra00072  Synthesis and degradation of ketone bodies
acra00280  Valine, leucine and isoleucine degradation
acra00310  Lysine degradation
acra00362  Benzoate degradation
acra00380  Tryptophan metabolism
acra00620  Pyruvate metabolism
acra00630  Glyoxylate and dicarboxylate metabolism
acra00640  Propanoate metabolism
acra00650  Butanoate metabolism
acra00900  Terpenoid backbone biosynthesis
acra01100  Metabolic pathways
acra01110  Biosynthesis of secondary metabolites
acra01120  Microbial metabolism in diverse environments
acra01130  Biosynthesis of antibiotics
acra01200  Carbon metabolism
acra01212  Fatty acid metabolism
acra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY15_2091
   00630 Glyoxylate and dicarboxylate metabolism
    BSY15_2091
   00640 Propanoate metabolism
    BSY15_2091
   00650 Butanoate metabolism
    BSY15_2091
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY15_2091
   00072 Synthesis and degradation of ketone bodies
    BSY15_2091
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY15_2091
   00310 Lysine degradation
    BSY15_2091
   00380 Tryptophan metabolism
    BSY15_2091
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY15_2091
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY15_2091
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY15_2091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acra04147]
    BSY15_2091
Enzymes [BR:acra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY15_2091
Exosome [BR:acra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY15_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Dodecin ACP_syn_III_C DUF5423
Motif
Other DBs
NCBI-ProteinID: AOG22620
UniProt: A0A1B3PIM4
Position
complement(2317844..2319049)
Genome map
AA seq 401 aa AA seqDB search
MTEAYVFDALRTPRGKGKKDGTLHEVKPIDLLAGLLTELQARHRFDTAAVDDVVMGIVSP
VGEQGSVLPKVAALKAGWDFRCAGVQVNRFCASGLEAVNMAAQKVRSGWEDLVVAGGVES
MSRVPIGSDGGAWAQDPATNSATLFVPQGIGADLIATLDGYTRADVDAFALESQRRATAA
RAAGYFKNSVVPVRDFIGQTILAEDEFIKPKTTLEGLGALKPSFEQLGGMGFDAVALQRY
PQVERIHHVHHAGNSSGIVDGAAAVLIGNEAAAKAHGLTPRARIVATALSGADPTIMLTG
PVPAAKKALARAGMTIDQIDLFEVNEAFAAVPMRFMRELGVPHDKVNVNGGAIAMGHPLG
ATGAMILGTLIDELHRRGQRYGLATLCVGGGMGIATIVERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctatgtatttgacgcgctgcgcaccccgcgcggcaagggcaagaaagac
ggcaccctgcacgaagtcaagcctattgacctgctggccggcctgctcaccgagctgcag
gcacgccaccgctttgacaccgccgcagtggacgatgtggtcatgggcatcgtctcgccc
gtgggcgagcagggctcggtgttgcccaaggtggcggcgctcaaggccgggtgggacttt
cggtgtgcaggcgtgcaggtcaaccggttctgcgcatcgggcctggaggccgtgaacatg
gccgcgcaaaaggtgcgcagcggctgggaagacctggtggtggccggcggcgtggagagc
atgagccgggtgcccattggctctgatggcggcgcctgggcgcaggaccccgccaccaac
tccgccacgctgttcgtgccccagggcatcggcgccgacctgatcgccacgctggacggc
tacacccgcgccgacgtggacgccttcgcgctcgaatcgcagcgccgcgccaccgccgcg
cgcgcagcgggctacttcaagaactctgtggtgcccgtgcgcgacttcatcggccagacc
atcctggccgaagacgagttcatcaagcccaagaccacgctggagggcctgggtgccctc
aagccctcgttcgagcaactgggcggcatgggctttgacgcagtggcgctgcagcgctac
ccacaggtggagcgcatccaccacgtgcaccacgcgggcaactcgtcgggcatcgtggac
ggcgcggctgccgtgctcatcggcaatgaggccgctgccaaggcccacggcctcacgccg
cgcgcgcgcatcgtggccaccgcgctcagcggcgccgaccccaccatcatgctcaccggt
cccgtgcccgctgccaaaaaggcgctggcccgtgcgggcatgaccatcgaccagatcgac
ctgttcgaagtgaacgaggccttcgccgctgtgcccatgcgcttcatgcgcgagctgggc
gtaccgcacgacaaggtcaacgtgaacggcggcgccatcgccatgggccacccgctcggc
gccacgggcgccatgatcctcggcaccctgattgacgagctgcaccgcagaggccagcgc
tatggcctggccacgctgtgcgtgggtggcggcatgggcattgccaccatcgtcgagcga
atctga

DBGET integrated database retrieval system