KEGG   Acidovorax sp. RAC01: BSY15_2804Help
Entry
BSY15_2804        CDS       T04481                                 

Definition
(GenBank) phoD-like phosphatase family protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00790  Folate biosynthesis
acra01100  Metabolic pathways
acra02020  Two-component system
Module
acra_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSY15_2804
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY15_2804
Enzymes [BR:acra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSY15_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AOG24738
UniProt: A0A1B3PPN6
Position
complement(3127889..3129466)
Genome map
AA seq 525 aa AA seqDB search
MNPYQRRVFLQHAAWAAAATALPRWAWSNPPALQSNPFALGVASGDPAPDGVVLWTRLVL
ADPAQMQAPHTVRWEVAHDARFAQIVQKGQAVASPDLGHSVHVEVAGLAPDRWYHYRFML
GDAVSATGRTRTAPAADVLTQKLRVAFASCQRWEHGHYAAWRHLVSDEPDLVLFLGDYIY
EYATPRNTDGLARTHSLRHASTLADYRDRYALYKSDPHLQAAHAACPWAVTWDDHEVQND
YAAEAGRGSDPAAFGAQRSAGWQAFYENMPLRAASLASAAGGAPWSTLQVFRRLRWGRLA
HIHLLDTRQYRSWQACRQPDTTGAGAVRPADCPTLADPARTLLGTAQERWLDTGLAADAR
TTDATRWSVIAQQTLFSARQYPSGLVPTDSWDGYPAARARLLHSVAGHAPRNTVLLGGDI
HQNYVCRVQAKPLRTGSPVLASEFCGTSISSRAGTTQDKVNAIARQNPHVLLARPDQRGY
GLADITPARWMTTLRVVDDPLRADSGAAIQARFVVDDGHPGPMAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacccataccagcgtcgcgtatttctgcagcacgcagcctgggccgcagcggccacc
gccctgccccgctgggcatggagcaacccgcccgcgctgcaatccaacccgtttgcactg
ggagtggccagtggcgacccggcccccgacggtgtggtgctgtggacgcggctggtgctg
gccgacccggcgcagatgcaggccccgcacaccgtgcggtgggaggtggcgcacgatgca
cggtttgcgcagatcgtgcaaaaaggccaggctgtggcgagccccgaccttgggcacagc
gtgcatgtggaggtggcgggcctggcgcccgaccgctggtaccactaccgcttcatgctg
ggcgatgccgtgagcgccaccgggcgcacgcgcaccgcgcctgctgccgatgtgctcacg
cagaaactccgggtggcgttcgcatcgtgccagcgctgggagcacgggcactacgccgcg
tggcggcacctggtgtcagatgagcccgacctggtgctgtttctgggcgactacatctac
gaatacgccaccccgcgcaacaccgatggactggcgcgcacgcacagcttgcgccacgcc
agcaccctggccgactaccgcgaccgctacgcgctgtacaagagcgatccgcacctgcag
gcggcccacgcggcctgcccctgggcggtgacttgggacgaccatgaagtgcaaaacgac
tacgccgccgaagcggggcgcggcagcgaccctgcggcttttggcgcgcagcgcagcgca
ggttggcaggcgttttacgaaaacatgccgctgcgtgcggcctcgctggccagcgccgca
ggcggcgcgccgtggagcaccctgcaggtgttccgccgtctgcgctggggccggctggca
cacatccacctgctggatacacgccagtaccgcagctggcaggcctgccgccagcccgac
accacaggcgcaggggcggtgcgcccggccgactgccccacgctggccgacccggcccgg
accctgctgggcaccgcgcaggagcgctggctcgataccggcctggccgcggatgcgcgc
actacggatgccacccgctggagcgtgatcgcgcagcagacgctcttttcggcccgccag
tacccttcgggcctggtccccaccgacagctgggacggctaccccgccgcccgcgcccgc
ctgctgcattcggtggcaggccatgcgccgcgcaacaccgtgctgctgggcggcgacatc
caccagaactacgtctgccgcgtgcaggccaagccgctgcgcaccggctcgcccgtgctg
gccagcgagttctgcggcacctccatcagctcgcgcgccggcaccacgcaagacaaggtg
aacgccatcgcccgccaaaacccgcatgtgctgctggcgcggcccgaccagcgcggctac
ggcctggccgacatcacccccgcccgctggatgaccaccctgcgcgtggtggacgacccg
ctgcgcgcagacagcggcgccgccatccaggcacgctttgtggtggacgacggccacccc
gggcccatggcggcctga

DBGET integrated database retrieval system