KEGG   Acidovorax sp. RAC01: BSY15_3417Help
Entry
BSY15_3417        CDS       T04481                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acra  Acidovorax sp. RAC01
Pathway
acra00071  Fatty acid degradation
acra00072  Synthesis and degradation of ketone bodies
acra00280  Valine, leucine and isoleucine degradation
acra00310  Lysine degradation
acra00362  Benzoate degradation
acra00380  Tryptophan metabolism
acra00620  Pyruvate metabolism
acra00630  Glyoxylate and dicarboxylate metabolism
acra00640  Propanoate metabolism
acra00650  Butanoate metabolism
acra00900  Terpenoid backbone biosynthesis
acra01100  Metabolic pathways
acra01110  Biosynthesis of secondary metabolites
acra01120  Microbial metabolism in diverse environments
acra01130  Biosynthesis of antibiotics
acra01200  Carbon metabolism
acra01212  Fatty acid metabolism
acra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY15_3417
   00630 Glyoxylate and dicarboxylate metabolism
    BSY15_3417
   00640 Propanoate metabolism
    BSY15_3417
   00650 Butanoate metabolism
    BSY15_3417
  Lipid metabolism
   00071 Fatty acid degradation
    BSY15_3417
   00072 Synthesis and degradation of ketone bodies
    BSY15_3417
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY15_3417
   00310 Lysine degradation
    BSY15_3417
   00380 Tryptophan metabolism
    BSY15_3417
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY15_3417
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY15_3417
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSY15_3417
Enzymes [BR:acra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY15_3417
Exosome [BR:acra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY15_3417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOG23403
UniProt: A0A1B3PKX4
Position
3814709..3815887
Genome map
AA seq 392 aa AA seqDB search
MEDIVIVSAARTAVGKFGGALAKVPATELGAIVIREAIARAGLSDAQVGEVIMGQVLTAG
VGQNPARQASMKAGVAKETPALTINAVCGSGLKAVMLAAQAVAWGDSEIVVAGGQENMSL
APHVLNGSRDGQRMGDWKMVDSMIVDGLWDVYNQYHMGITAENVAKQYGISRDMQDALAL
ASQQKAAAAQDAGRFVDEIVNVSLPQKKGDPIIFNTDEYLNRKTNAEALAGLRPAFDKAG
SVTAGNASGLNDGAAAVVVMTAKKAAALGLKPLARIAAFGTSGLDPATMGMGPVPASRKA
LERAGWNAADVDLFELNEAFAAQACAVNKELGIDPARVNVNGGAIAIGHPIGASGCRILV
TLLHEMQRRDAKKGLAALCIGGGMGVSLALER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtttcggccgcccgtaccgctgtgggcaaattcggcggcgcg
ctcgccaaggtcccggccaccgaactgggcgctatcgtcattcgcgaagccatcgcccgc
gctggcctgtcggacgcccaggtgggcgaagtcatcatgggccaggtgctgaccgcaggc
gtgggccagaaccccgcgcgccaggcctcgatgaaagccggtgtggccaaggaaaccccg
gccctcaccatcaacgccgtctgcggctcgggcctgaaggccgtgatgctggcagcccag
gccgtggcctggggcgacagcgaaatcgtggtggccggtggccaggaaaacatgagcctg
gccccccacgtgctcaacggttcgcgcgacggccagcgcatgggcgactggaagatggtc
gactccatgatcgtcgatggcctgtgggacgtgtacaaccagtaccacatgggcatcacc
gccgagaacgtggccaagcaatacgggatcagccgcgacatgcaggatgcactggccctg
gccagccagcaaaaggccgctgccgcgcaggacgcaggccgcttcgtcgacgaaatcgtg
aatgtctcgctgccgcaaaagaagggcgacccgatcatcttcaacaccgacgagtacctc
aaccgcaagaccaacgccgaagcgctggcgggcctgcgccctgcctttgacaaggccggc
agcgtgacggccggcaatgcgtcgggcctgaacgacggtgcagccgctgtggtggtgatg
acggccaagaaggccgcagccctgggcctcaagcccctggcacgcattgccgctttcggc
accagcggcctggaccctgccaccatgggcatgggccccgtgccggcttcgcgcaaggcg
ctggagcgtgcgggctggaatgcggccgatgtcgacctgttcgagctgaacgaagccttt
gccgcgcaggcctgcgctgtgaacaaggagctgggtatcgaccccgcccgcgtcaatgtg
aacggcggcgccattgccattggccaccccatcggagcgtctggctgccgcattctggtg
acgctgctgcacgaaatgcagcgccgcgacgcgaagaagggcctggctgcactgtgcatt
ggcggcggcatgggcgtgtcgctggcactggagcgctga

DBGET integrated database retrieval system