KEGG   Arthrobacter crystallopoietes: AC20117_19730Help
Entry
AC20117_19730     CDS       T05322                                 

Definition
(GenBank) bifunctional D-altronate/D-mannonate dehydratase
  KO
K08323  mannonate dehydratase [EC:4.2.1.8]
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00040  Pentose and glucuronate interconversions
acry01100  Metabolic pathways
Module
acry_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:acry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AC20117_19730
Enzymes [BR:acry01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     AC20117_19730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AUI52692
UniProt: A0A1H1G9Z3
Position
4272625..4273854
Genome map
AA seq 409 aa AA seqDB search
MKIIAADVIVTSPSRNFVTLKITTDDGVTGLGDATLNGRELAVATYLKEHVAQLLIGKDP
HRIEDTWQFLYRSSYWRRGPVTMAAIAAVDMALWDIKGKVAGLPVYQLLGGASRTGLRTY
GHASGRDIPELFDSIRQHLEEGYKSIRVQTSVPGIKALYGVAAQAQATGERYDFEPAGRG
AQPTEEDWDTRAYLRHLPTVFEAVRNEFGPELPLLHDGHHRMTPIQAAKLGKSLEPYDLF
WLEDCTPAENQEALRLVRQHTTTPLAIGEIFNTVFDFQTLIKEQLIDYVRAASTHFGGIS
PLKKVMDFAAQYQVKSGFHGPTDVSPVGLAAQTHVGLAIHNFGIQEYMEHSEKTNTVFEQ
SMVFADGYLHPGDKPGLGIELNEEAAASFPYQQAYLPYNRLADGTVHDW
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcattgctgctgatgtcattgtgaccagccccagccggaactttgtgacgctg
aaaatcaccacggatgacggtgttaccggtctgggagatgccactctgaacggccgcgag
ctggccgtggcaacttatttgaaggaacacgttgcgcagctgctgatcggcaaggatccg
caccggatcgaagacacatggcagttcctctaccgcagctcctactggcgccggggccct
gtcactatggccgcaatcgccgccgtcgacatggcgctgtgggacatcaagggcaaggtt
gccgggctgccggtctaccaactgctgggcggcgcctcaaggaccggtctgcgcacttac
ggccatgcctccggccgcgacattccggaattgttcgactccatccggcagcatctggaa
gaaggctacaagtccattcgtgtgcagacgtccgtgccggggatcaaagcactctacggt
gttgctgcccaggcacaggcgacgggtgagcgctatgacttcgaacccgccggccggggt
gcgcagccgaccgaggaagattgggacacccgggcctacctgcgccatctccccaccgtc
ttcgaagccgtccgtaacgagttcggcccggagttgccgttgctgcatgacggacaccac
cggatgaccccgatccaggcagccaagctgggcaagtcactcgagccgtacgatctgttc
tggcttgaggattgcacccccgctgagaaccaggaagcgctccggctggtccgccagcac
accaccaccccgctggcgatcggcgaaatcttcaacacggtcttcgatttccagacgctg
atcaaagaacagctgatcgactatgtccgtgcggcttcgacacacttcggcggcatctcc
ccgttgaagaaggtcatggacttcgccgcccagtaccaggtcaagtcgggcttccacggc
cctacggatgtctccccggtcggccttgcagcgcagactcacgtcgggctggctatccat
aacttcggtatccaggaatacatggagcacagcgagaagaccaatacggtgtttgagcag
tccatggtctttgccgacggttatctgcacccgggcgacaagcccggactcggcatcgag
ctgaacgaagaagccgcggcttccttcccctaccagcaggcctacctgccgtataaccgt
ctcgccgacggcacggtgcacgactggtga

DBGET integrated database retrieval system