KEGG   Arthrobacter crystallopoietes: AC20117_22975
Entry
AC20117_22975     CDS       T05322                                 

Definition
(GenBank) hypothetical protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
acry  Arthrobacter crystallopoietes
Pathway
acry00230  Purine metabolism
acry01100  Metabolic pathways
acry01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acry00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AC20117_22975
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4 DHODB_Fe-S_bind
Other DBs
NCBI-ProteinID: AUI53804
UniProt: A0A1H1HW45
Position
pLDW-10:183467..183985
AA seq 172 aa
MNEMNEEISVTCRINGEDVALHGDPAGSTVSVLRARGLFGVRETCGLGVCGTCTVLLNGE
PVSSCILPMYALDGGTIRTVEGAASGDTLSALQQQFIESQAFQCSFCTPGFLASAQALLD
QTEGELTREQVESGLQGHLCRCGSYEAISEAVRICSRNRGCAADASTGCPAS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaatgaaatgaatgaggagatctcggtaacttgtcggataaacggggaggacgtagcg
ttgcacggcgaccccgccggttcgacagtatcggtgctgagggcacgcgggctgttcgga
gtgagggaaacctgcggtttgggtgtctgcggcacctgcaccgtgctgctcaatggcgaa
ccggtgagcagctgcatcctgccgatgtatgccctggatggcggtacgatccggacggtg
gagggtgccgcatccggagacacgctcagcgcactccagcagcagttcatcgagtcccag
gccttccagtgttcgttctgcacgccgggattcctggccagcgcccaggccctgctcgac
cagaccgagggcgaactgacacgcgagcaggtcgagagcgggttgcagggccacctgtgc
cgttgcggctcctacgaagccatcagtgaggcagtccgcatctgcagccgcaaccgcggc
tgcgccgcggacgcatcgaccgggtgcccggcgtcctga

DBGET integrated database retrieval system