KEGG   Anolis carolinensis (green anole): 100551548
Entry
100551548         CDS       T01608                                 

Gene name
fastkd2
Definition
(RefSeq) FAST kinase domains 2
  KO
K18190  FAST kinase domain-containing protein 2
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acs03029]
    100551548 (fastkd2)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100551548 (fastkd2)
SSDB
Motif
Pfam: FAST_1 RAP FAST_2 DBD_HTH HMG_box_5 UNC45-central
Other DBs
NCBI-GeneID: 100551548
NCBI-ProteinID: XP_008113136
Ensembl: ENSACAG00000009610
UniProt: H9GFE7
Position
Un
AA seq 685 aa
MSWKLNCFIRTTKQLQACPYVLSPFSRTAVKSFTLGNNGHKNTVRNNNLRQLLFYSPPFC
LQSSIRGFSQDVPSINTEREDPNEQKTASALFDDDGPIPAPVTVKDPQHASDFLTSARED
SSAIEENDERSASRQFFDELRKCTSPCDVLDLVARFPVSEKYVSNSLATMWMLTKKLSED
QKRYEKRLMFEHPQFSQVCQSVMNEAKFMWRDDLAYSFLAVVRLGIPQSTRLVQTLLRVC
QERLNEFDDRCLSIVATTLQGMEKNKNVDALQIGLQLVVEQRIPKISNMFMLQTMMKCIG
KDAPLTLKKKLESKALSQMHQFTLPNAQHMFGVLAEMNHRSLPILEACSNKIIENIQGIP
FWPLLNVLRSCRDLHYRNSALYYTISDYAATAFYMWDIKQVVLFLLAFENLSFRPVHLMD
KFAEKVMSRPESLNMRDTVSVLKSYSLLNHTPKGQKDRFLEALNSALKTYLSRISNADLL
RAVYSFCIFGYLPQPALDQLLQDEILHDLVTSDGQNVEQNERMLHAINVCLELDGNSLTK
RAALPTDKLPSPALDFLDVQEVLLTLLGDGSLFRENVQLANGYNLDFEILMDANRSVVMP
NTDPDQLGDNSNIQRIALLCAPVSAFCVDSRHPRGRLAMKMRHLRLLGYRVILIHYQEFQ
KLKKEEAHEFLKGEIFSAETSSPSN
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgagttggaaactgaattgctttatacggacaacgaagcagttgcaggcatgcccttat
gtcctgagtcctttttctagaactgcagtgaaatcttttacactgggaaataatggacat
aaaaatactgtgcgaaataataatctgaggcaactcctgttttattcacctcctttctgt
cttcagtcatctattcgggggttttctcaagatgtcccatctatcaacacagaaagggaa
gacccaaatgaacagaaaactgctagtgccctgtttgatgacgatgggccaatccctgca
ccagtgactgtcaaagatcctcaacatgcatctgatttcttgacttctgcaagggaagac
agtagtgctattgaagaaaatgatgaaaggagtgcatcccggcaattctttgatgagctt
cggaagtgtacatctccctgcgatgtccttgatcttgttgcaagatttccagtctctgaa
aagtatgtcagtaacagtctggctaccatgtggatgctcacaaaaaagctctcagaagac
cagaagcgctatgagaagaggctgatgtttgagcacccccagtttagtcaagtctgccaa
agtgttatgaatgaagctaagttcatgtggcgtgatgacttggcctacagctttctggct
gtggtgagactgggaattcctcagagcacccggttggttcagaccctgcttagggtatgc
caggaacgtctcaatgaatttgatgatcgatgcctctccattgtggcaactactttgcaa
ggaatggaaaaaaacaagaatgtggacgctcttcagattggattgcagttggtggtagag
cagcgcatccccaaaatctcaaatatgtttatgttgcaaactatgatgaagtgtattggg
aaggatgccccactcactctaaagaaaaaactggagagcaaagcactgagtcagatgcac
cagtttactctcccaaacgctcaacacatgttcggtgtgttggctgaaatgaatcatcgc
tcacttccaattctggaagcttgtagcaacaaaataatagagaatatccagggaattcca
ttttggccactgctgaatgttttgaggtcttgcagagacctccattatcgcaacagtgca
ctctattatacaatatcagattatgccgccacagctttctacatgtgggacataaagcag
gtagtcctctttcttttggcctttgagaatcttagcttccggcctgttcatctgatggat
aagtttgctgagaaagtgatgtctcgtcctgaatctttgaacatgagggacacagtgtct
gttctgaaatcctattctcttcttaatcatactcccaaaggccaaaaggacagatttctt
gaggctctgaatagtgccttgaagacgtacctctccaggatctctaatgcggacctacta
agggctgtatattctttctgcatttttggataccttccacaaccagcacttgatcaacta
ctgcaagatgaaatcctccatgatctggtgacatcagacggccagaatgtagaacaaaat
gaaaggatgctgcacgccatcaatgtttgccttgaacttgatggaaattcattgactaaa
cgagcagctttaccaacagacaaactcccttcgcctgctttggattttcttgatgttcag
gaggtgctgcttacgcttctgggagatggaagtctgttccgagaaaacgtacagttagca
aatggctacaacctagattttgaaatcttaatggatgcaaacagaagtgtagtgatgcca
aatactgatcctgatcagttaggagataattctaacattcaaaggatagctttgctatgt
gcccctgtgtctgccttctgtgttgactcaaggcatccccgaggaaggctagcaatgaag
atgaggcacttgcgccttctaggttatcgtgtgattctgattcattaccaggaattccaa
aaactgaagaaagaagaggctcatgaattcttaaaaggagaaatattttcagcagaaaca
tcttcaccttctaattag

DBGET integrated database retrieval system