KEGG   Anolis carolinensis (green anole): 100551586
Entry
100551586         CDS       T01608                                 
Symbol
arl14ep
Name
(RefSeq) ADP ribosylation factor like GTPase 14 effector protein
Organism
acs  Anolis carolinensis (green anole)
SSDB
Motif
Pfam: ARF7EP_C Transposon_TraM
Other DBs
NCBI-GeneID: 100551586
NCBI-ProteinID: XP_003214731
Ensembl: ENSACAG00000002019
Position
1:59504398..59515806
AA seq 260 aa
MDPCSVGNQLQASSDCHKTFFTSQTGFKRKQDFSSTDLLLLQLRTGITFTENNMICFHHA
KVYLDRYEDLQKSCCDPFNIHKKFSRKNLHVIDINDATFLSAKFGRQFIPGWKLCPKCTQ
IINGNAEVDSEDRQRRRLDSDGRTAKALKSLQFANPGRHTGFAPEVNKREKRRLQTKSTS
VNSDRQVIPTKSKVYDSQGFLLYSGIDLCDCLDEDCLGCFYACPKCGSSKCGPECRCDRK
WLYEQIEIEGGEIIRNKKTG
NT seq 783 nt   +upstreamnt  +downstreamnt
atggatccgtgttcagttggaaatcagctgcaagctagcagtgattgccataaaacattc
tttacctctcaaactggcttcaagcgtaaacaagatttttcatcaactgatctattactc
cttcagcttaggactgggataacctttacagagaacaacatgatctgtttccatcatgct
aaagtttaccttgatagatatgaagacttgcaaaagtcatgttgtgatccctttaatata
cacaaaaaattttcaaggaaaaacttgcatgtaattgacataaatgatgctacttttcta
agtgccaagtttggacggcagtttatacctggctggaagctttgtccaaaatgtacacag
ataataaatggaaatgcagaggttgattctgaagaccgccagcgaagaagacttgattca
gacgggcgtacagctaaagccttgaaatccttacagtttgctaatccaggacgacatact
ggatttgctccagaagtaaacaaaagagaaaaaagaagactccaaacaaaaagcacatcc
gttaattcagataggcaggtaatacccacaaagagcaaagtgtacgatagtcaaggattc
ctgctttatagtgggatagacctctgtgactgtctcgatgaagattgcctaggatgtttt
tatgcctgtccaaagtgcggctccagcaagtgtggacctgaatgtcgttgcgatcggaag
tggctatatgaacaaattgagattgaaggaggagaaattatacggaataagaaaacagga
tag

DBGET integrated database retrieval system