KEGG   Anolis carolinensis (green anole): 100551935Help
Entry
100551935         CDS       T01608                                 

Gene name
prkaa2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04068  FoxO signaling pathway
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04910  Insulin signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100551935 (prkaa2)
   04068 FoxO signaling pathway
    100551935 (prkaa2)
   04150 mTOR signaling pathway
    100551935 (prkaa2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100551935 (prkaa2)
  Cellular community - eukaryotes
   04530 Tight junction
    100551935 (prkaa2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100551935 (prkaa2)
   04920 Adipocytokine signaling pathway
    100551935 (prkaa2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100551935 (prkaa2)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100551935 (prkaa2)
Membrane trafficking [BR:acs04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100551935 (prkaa2)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100551935 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    100551935 (prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100551935
NCBI-ProteinID: XP_003220224
Ensembl: ENSACAG00000006771
Position
4
AA seq 554 aa AA seqDB search
MAEKPPPPQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLD
VVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEETEA
RRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGS
PNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKIRGGVFYIPEY
LNRSVATLLMHMLQVDPLKRATIKDMREHEWFKQDLPNYLFPEDPSYDANVIDDDAVREV
CEKFECTESEVMASLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSM
HIPPGVKPHPERMPPLVADSPKAKCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMA
EVYRAMKQLEFEWKVVNAYHLRVRRKNPVTGNFVKMSLQLYQVDNRSYLLDFKSIDDDVM
EQRSGSSTPQRSCSAARLHRPRLSFDSASADYQPLSGSLSGSFTGSMPSVTPRLGSHTMD
FFEMCASLIMALAR
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcctcctccgccgcagaagcacgacgggcgcgtcaagatcggccactac
gtcttgggagacacgctgggcgtcggcaccttcggcaaagtcaagattggtgaacatcag
ctcacaggacataaagtagcagtcaaaattttgaataggcaaaaaatccgcagtttggat
gtggttggaaagatcaaacgagaaattcaaaacttaaagcttttccggcacccccatatt
atcaaactgtaccaggtcatcagcacgccaacggattttttcatggtaatggaatatgtg
tccggtggggaattatttgattacatctgtaaacacggacgggtggaagagactgaagcc
agacgtcttttccagcaaattctgtcagctgtagattactgtcatcggcacatggtggtt
catagagatttgaaaccagagaatgtgctgttggatgcacacatgaatgccaagatagct
gattttgggttgtccaacatgatgtctgatggtgaatttctccgaaccagctgtggctca
cccaactatgcagcaccagaagtcatctctggaaggttgtatgctggtccagaggttgat
atttggagctgtggcgttattctttatgctcttctctgtgggactcttccttttgatgac
gaccatgtcccaacactctttaaaaaaatccgtggaggtgtcttctacattcctgaatac
cttaaccgctcagttgctactctactgatgcatatgttgcaggttgacccactcaaaaga
gcaaccataaaggatatgcgagaacatgagtggttcaagcaggatctgcccaattacttg
tttcctgaagacccttcctatgatgccaatgtcattgatgatgatgctgtgcgggaggtt
tgtgagaaatttgaatgcactgaatcagaggtgatggcaagcctatacagtggagatcct
caagatcaacttgcagttgcttatcaccttattattgacaatcggagaatcatgaaccaa
gccagtgaattctacctcgcttccagccctccttctggctcttttatggatgactctatg
cacatccctccaggggtaaaacctcacccagagcggatgcctccattggtagcagatagt
cccaaagcaaaatgtcccctcgatgcactgaataccactaagccaaaaccattgactgtg
aaaaaggccaagtggcatttagggatacggagtcaaagcaagccttatgatatcatggct
gaagtctaccgtgctatgaaacaactggagtttgaatggaaggtggtgaatgcttatcat
cttagagttcgtagaaaaaatccagtgacggggaatttcgtaaaaatgagtttgcagctg
tatcaggttgacaatcgtagctatctactggactttaaaagtattgatgatgatgtcatg
gaacaaagatcaggctcttccactcctcagcgctcatgctctgcagctcgactgcacaga
ccaagactgagttttgattctgcctctgctgattaccaaccactttcggggtctctcagt
ggctccttcacaggtagcatgccctctgttacacctcgccttggcagccataccatggat
ttctttgaaatgtgtgctagtctcatcatggctcttgcacgctga

DBGET integrated database retrieval system