KEGG   Anolis carolinensis (green anole): 100552477Help
Entry
100552477         CDS       T01608                                 

Gene name
acvr1c
Definition
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04060  Cytokine-cytokine receptor interaction
acs04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100552477 (acvr1c)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100552477 (acvr1c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acs01001]
    100552477 (acvr1c)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100552477 (acvr1c)
Protein kinases [BR:acs01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100552477 (acvr1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH zf-RING_12
Motif
Other DBs
NCBI-GeneID: 100552477
NCBI-ProteinID: XP_003224654
Position
Un
AA seq 337 aa AA seqDB search
MRTALPSRLCAAGLLLLSAGAFLCTGLTCVCQLCEKTNFTCETEGACWASVMLTNGRQEV
TKACVTLPELKAQIFCHSSKNITRTECCYTDFCNNITIHLPTDNGTWTQLWLVSEYYEQG
SLFDYLNSNTVTVDGMIKLTFSIASGLAHLHMEIVGTQGKPAISHRDLKSKNILVKRNET
CAIADLGLAVKHDSALNTIDIPQNPRVGTKRYMAPEILDDTMNMNIFESFKRADIYSLGL
VYWEISRRCSVGGIVEEYQLPYYDVVPSDPSIEEMRKVVCEQKLRPNIPNQWHSCEALRV
MGRIMRECWYTNGAARLTALRIKKTISQLCVREESKA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcggacagcgctcccgtcccggctctgcgccgccgggctcctgctcctctccgccggc
gcctttctttgcacaggtctaacatgtgtgtgccaattgtgtgaaaaaacaaacttcaca
tgtgaaacagagggagcctgttgggcttcagtcatgctaacaaatggtcggcaagaggta
accaaggcatgtgtgaccctaccggaactgaaagcacaaatcttctgccacagttctaaa
aacatcaccaggacagaatgctgctatactgatttctgcaataacatcaccattcacttg
cccacagataatggtacttggactcagttgtggcttgtatctgaatactatgaacaaggc
tctttgtttgattacttaaacagcaatactgtcacggtggatgggatgattaaactgacc
ttctccatagcaagtggtctggcacatcttcacatggagattgtcggcacacaaggcaaa
ccagctatttcacatagagatttgaaatctaaaaacattttagtcaaaaggaatgaaacc
tgtgccattgctgacctgggtctggctgtgaaacatgactctgcattaaacacaatcgac
atacctcagaatcctagagtgggaaccaagaggtacatggcaccagaaatacttgatgac
acaatgaatatgaatatctttgaatccttcaagcgggcagatatctattctcttggactg
gtgtactgggagatatcccgaagatgctcagttggagggattgttgaagaataccagtta
ccttattatgatgttgtgccttctgatccttcaatagaagagatgagaaaggttgtctgt
gaacaaaaactgagacctaacatccccaatcaatggcatagctgtgaggctctcagagta
atgggccgcatcatgcgtgagtgctggtataccaatggggcagctcgtctgacagcgctt
cgcatcaagaagaccatttctcagctctgtgtgcgagaggagtccaaggcttaa

DBGET integrated database retrieval system