KEGG   Anolis carolinensis (green anole): 100553568Help
Entry
100553568         CDS       T01608                                 

Gene name
b4galt4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00533  Glycosaminoglycan biosynthesis - keratan sulfate
acs00601  Glycosphingolipid biosynthesis - lacto and neolacto series
acs01100  Metabolic pathways
Module
acs_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100553568 (b4galt4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100553568 (b4galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acs01003]
    100553568 (b4galt4)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     100553568 (b4galt4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     100553568 (b4galt4)
    2.4.1.-  
     100553568 (b4galt4)
Glycosyltransferases [BR:acs01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   100553568 (b4galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 100553568
NCBI-ProteinID: XP_003219261
Ensembl: ENSACAG00000004513
UniProt: G1KCW6
Position
3
AA seq 354 aa AA seqDB search
MGLSYGKLQVSYKLKLLMLFSLCILLVGWVTSSYLLYAVHENPKTKSLLRNDRKATTAAG
EQNGNSDRDTMSTVKLPNMMMPPCPSQSPYLRGPSKLTFKASLTLEEVQKENPQVTKGRF
HPKDCLALQRVAILIPHRSREKHLLYLLEHLHPFLQRQQLDYGIYVIHQAGNAKFNRAKL
LNVGYLEALKEENWDCFIFHDVDLVPENDFNIYVCGSQPKHLVVGRNSTGYRLRYQGYFG
GVTALTREQFSKVNGFSNNYWGWGGEDDDLRIRVEMQKMKVIRPSPSVAKYTMIFHTRDR
GNEANGQRMNLLRQVSRVWKMDGLNSCSYNLLSMEYNPLYTNITVDFGRPTKIS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgagctatggcaagcttcaagtctcctacaagctcaaactcttgatgctcttc
agtttgtgtatcttgctggtgggttgggtcacttcttcttatctattgtatgctgtccat
gagaatccaaagacaaaaagcttattacgaaatgacagaaaagcaaccactgctgcaggg
gagcaaaacggaaactcagacagggataccatgtctactgtgaaactgcccaatatgatg
atgcctccttgtccctcccagtctccctatctgcgaggccccagcaagcttacattcaaa
gcatctctcaccctagaagaggtgcaaaaagaaaatcctcaggtcacaaaaggacgcttt
catcccaaagactgcttagctctgcaacgagttgctatattgattccgcaccgcagtcgt
gagaagcatctattgtacctgctggagcaccttcacccttttttgcagcggcaacagctg
gactatggcatatatgtcatccaccaggctggcaatgctaagttcaacagggcaaaactg
ctgaatgtaggatacctagaagccctgaaggaagagaactgggattgcttcatcttccac
gatgttgacctggtgccagagaatgacttcaacatatatgtgtgtggtagtcagccaaag
cacttagtagtgggcagaaacagcacaggctacaggttgcgttaccaaggatactttggg
ggtgtaactgctctaacaagggagcaattctcaaaggtgaatggattttctaacaactac
tggggctggggaggagaggacgatgacctccggatcagggttgaaatgcagaaaatgaag
gttatcaggccttctcccagtgtagccaagtacacaatgatctttcatacaagagaccga
gggaatgaggcaaatggacagaggatgaatcttttgcgtcaggtatctagagtatggaaa
atggatggcctcaactcctgctcttataacctgctctctatggagtacaaccctttgtat
accaacattacagtggattttggcaggccaacgaagatttcataa

DBGET integrated database retrieval system