KEGG   Anolis carolinensis (green anole): 100554119Help
Entry
100554119         CDS       T01608                                 

Gene name
gna13
Definition
(RefSeq) G protein subunit alpha 13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04270  Vascular smooth muscle contraction
acs04371  Apelin signaling pathway
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100554119 (gna13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100554119 (gna13)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100554119 (gna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acs04147]
    100554119 (gna13)
   04031 GTP-binding proteins [BR:acs04031]
    100554119 (gna13)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100554119 (gna13)
  Exosomal proteins of colorectal cancer cells
   100554119 (gna13)
GTP-binding proteins [BR:acs04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100554119 (gna13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA GTP_EFTU FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 100554119
NCBI-ProteinID: XP_003224745
Ensembl: ENSACAG00000001881
UniProt: H9G5Q4
Position
Un
AA seq 377 aa AA seqDB search
MADFLPSRSSLSVCFPSCLLNSSEAEQQRKSKEIDKCLYREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGEDWDRSAREDFRATIYSNVLKGVRVLVDAREKLHIPWGNPANQTNGD
KLMAFDTRSGVAVQGMVETEVFLQYLPAIRSLWTDSGIQHAYDRRREFQLGESIKYFLDN
LDKLGEPDYLPSQQDILLARRPTKGIHEYDFQIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QKVSIKDYFPEFQGDPHNLTDVQKFLVDCFRTKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccatcgcggtcctcgctgtcggtctgcttcccgagctgcctgctg
aacagcagcgaggccgagcagcagcgcaagtccaaagagatcgacaagtgcctctaccgc
gagaagacctacgtcaagcggctggtcaagatcctgctgctgggcgccggcgagagcggc
aagagtaccttcctcaagcagatgcgcatcatccacggcgaggactgggaccgctcagcg
cgcgaggacttccgcgccaccatctacagcaacgtcctcaagggtgtaagagttcttgta
gatgctcgagagaaacttcatattccctggggaaatcctgctaatcaaacaaatggtgac
aagttgatggccttcgatacccgctcaggagtagcagtacaagggatggtggagaccgag
gtttttttacagtaccttccagcaataagatctttatggacagatagtgggatccagcat
gcctatgacagacgcagagaattccagttgggagaatctataaaatatttcctggacaac
ttggacaaacttggagaaccagactatcttccttctcagcaagatattttgttggcacga
agacctaccaaagggatccatgagtacgattttcagattaaaaatgttcccttcaagatg
gttgatgtaggtggccaaaggtcagagcgaaaacgttggtttgaatgctttgacagtgtc
acttcaatattgttcctggtttcatcaagtgaatttgaccaggtactaatggaggatcga
caaacaaatcgccttacagaatctctgaacatttttgaaacaatagtcaacaatcgggtt
ttcagcaatgtgtccatcattcttttcctaaacaagacagacttacttgaggaaaaagtg
caaaaagtgagtatcaaggactacttcccagaatttcaaggtgatccccacaacttgaca
gacgtccaaaaattcctggtggattgttttcgtaccaaacgccgggatcagcagcagaag
cccttataccaccacttcaccactgctattaatacagaaaacatccgccttgtgtttcgt
gatgtcaaggataccatccttcatgacaacctcaagcagctcatgctacagtga

DBGET integrated database retrieval system