KEGG   Anolis carolinensis (green anole): 100554189
Entry
100554189         CDS       T01608                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acs03021]
    100554189 (aff3)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100554189 (aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100554189
NCBI-ProteinID: XP_008118477
Ensembl: ENSACAG00000008164
UniProt: H9GDL2
Position
Un
AA seq 1195 aa
MDSFDLALLQEWDLDSLCVYDPDRNMLRRKEWERRNQDIQHDDGLFNTSYSLFSEPYKTN
KGDELSSRIQSTLGNYDEMKELLTDRSNQSHLVGVPKPCVSQTSVTKAEEHFTADPKPHT
QASICSPPTSLPVPPSGQLNKATTMGWQKSGYTLESQPRGAKHRHGLSDSHCNDFKIANQ
KNNLEKVKLYSSSPSSPSSSTATQGLLPSAPVDSIRTQQQPKLSCGADVGVQAQERTAMH
SNGHCVQNFPPSKPSIVQQKPTAYVRPMDGQDQAPDESPRLKVPAETSMVCSSYRGTPSA
KTDSTRTKSKPTKCDISKQDEDRAGDDSCVEEILRDSQHVSTGHNNQRKSGVEPKNPENR
TSHTSMLEDDLKLSSDEEDSEQQAAQRSALRVLSDSISVQQPNCRISGISSKRSSSTSSS
ESESSSESDSESESSSAESDCNKPPHYSSPEPEQPSSNKWQLDKWLNKVNPHKAPILNHN
GLESFQYYCKAKDQGHNCESLSSVCQTNLRDKEVKNPTKEELCPRTANKAPGHKGAKQKP
PPSATTVSVDSGPLRRTACRKQLRKTERTSGGDNLNSSTGDNPDLNRVPLENNSLCEQPK
PKPCTSKAEHRKEPQCVTPCEKRRTRGSGKIAPKSKEFIETESSSSTSSDTDSQSEQEEY
PLQKPYTVASVPVGSDQKLKDSGSSNTSKGNSCGAFGSVNTRTSNDIAKELDEQFYTLVP
FGRNELLSPLKDTDEVKALWVKIDLTLLSRVPQHSSEEPLLMNPGSKEAVGMQHNIAPDL
SAEKVIPKSRRKRKYENEEENRDSKKIHIEQLCSSHLLASSQVISTSNHCNMIKNSLGTP
INKNEKMLQSPVSPLPDASKHKFFSEDLTSSSKRNGSNLLSSISSSKRRKNESQTHHPGN
FNKMVYVSSDSTPLCNKTQCQKEPWSPVSSMHQDCRRSKLILNDGPHNIDYFMQEAKRKK
HKADAMVEKFSKALNYVEAALSFIECGNAMEQGPTESKSPYTMYSETVELIRYAVRLKTH
SVPSATPEEKQLATLCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKGAQAPSPWG
TSGKHTGTPSPISPSPSPVSSVGSQGSTGAPSPSSIVSIPQRIHQMAANHVSITNSILHS
YDYWEMADNLAKENQDFFNDLDALMGPVTLHSSMDHLVQYTQQGLLWIRSSAQFS
NT seq 3588 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttggcgctcctgcaggaatgggacctggattccctctgtgtctat
gatcctgacagaaatatgctgcgcaggaaagaatgggaaagaagaaatcaggatatccag
catgatgatggcttatttaacaccagttactctctcttcagtgaaccatacaagactaac
aagggggatgaactctccagtcggatccaaagtaccctgggcaactatgatgagatgaaa
gagctgttgaccgatagatccaatcaaagccatcttgttggtgttccaaagccttgcgta
tcacaaacatctgtgactaaagctgaggagcactttactgctgatccaaagccacatacg
caggcttccatttgcagtcctccaacgtccttgccagtgccaccatctggacagctgaac
aaggctacaactatgggttggcaaaagtctggatatactttggagagccagccaagggga
gctaaacataggcatggactatctgattcacattgtaatgactttaagatagctaaccaa
aagaacaatttagaaaaggtgaaactttattcatccagtccatcgtcaccatcttcatcc
actgctacccagggccttttaccatctgcacctgtagacagcatccgaacacaacagcag
ccaaagctgagttgtggagcagatgttggagtccaggctcaagaaaggacagcaatgcat
agcaatggacattgtgtacaaaactttcccccttcaaagcccagtatagttcagcagaaa
ccaaccgcttatgtaaggccaatggatggtcaggatcaggctcctgatgaatctccaaga
ctaaaggtaccggctgaaaccagcatggtctgtagttcatatagagggacaccttcagct
aaaactgattcaactaggaccaagtcaaaaccaacaaaatgtgatatctccaagcaagat
gaagatagagcaggtgatgacagctgtgttgaagaaattttacgggactcacagcatgtt
tctacagggcacaacaatcaaagaaaaagtggcgttgagccaaagaatccagaaaacaga
acatcacatacatcaatgttagaagatgatctcaaactgagcagtgatgaagaggacagt
gaacagcaggcagcacagagatctgctctccgggttctctctgacagcatttcagtgcaa
cagccaaactgcagaatctctggaatatccagcaagcgttcaagcagcaccagctccagt
gaatctgaaagcagctcagaatctgactcagagagtgaaagcagctctgcagagagtgac
tgcaacaagccccctcattattccagcccagagcctgaacagccatcatcaaacaagtgg
cagttagataaatggttaaataaagttaatcctcacaaagcacctattttgaatcacaac
ggactggagagctttcagtattactgcaaagcgaaagaccaagggcacaactgtgaaagt
ctgtcttctgtttgccaaaccaatctcagagataaagaggttaagaatcccaccaaggag
gaactgtgccccagaacagctaataaagccccagggcataaaggagcaaagcaaaaacca
cctccctcggccactacagtttctgtagacagtggtcctctgagaaggacagcatgtaga
aaacagctcagaaagacggagaggacctctggtggtgacaatttaaacagctctacaggt
gacaatcctgacttgaaccgagtacctttggaaaacaatagcctgtgtgaacaacctaaa
cctaagccctgtaccagcaaagctgagcatagaaaagaaccacagtgtgtcactccctgt
gaaaaacgacgcacaagaggatcaggtaaaatcgcacctaaatccaaggaatttattgag
acagaatcttcatcttcaacgtcttcagatacagattcacagtctgagcaagaggaatat
cctttacaaaagccttacactgtggcctcagtaccagttggaagcgaccagaaattaaaa
gactctggaagtagtaataccagcaaaggaaacagctgtggcgcctttggttcagttaac
acgcggactagtaacgatatagcaaaggagctggatgaacagttttatacacttgttcct
tttggcaggaatgaactcctgtctcctttgaaagacactgatgaagtgaaagcactttgg
gtcaaaattgatttgactcttttatccagagttcctcaacactcatccgaggagccgctg
ctcatgaatcctggtagtaaagaagcagttggtatgcagcataacattgccccagaccta
tctgcagagaaggttattccaaaatctagaaggaagcgtaagtatgaaaatgaagaagaa
aacagagacagcaagaagatacacattgaacaactatgttcctcccatttacttgcttca
agtcaagttatctctacatcaaatcactgcaacatgatcaaaaacagcttgggaacacca
ataaataaaaatgagaaaatgcttcagtcacctgtctcacccctccccgatgcatcaaaa
cacaaattttttagtgaggatttaacgtcttctagcaagcgtaatggtagcaacctctta
tcttccatttcctcaagcaaaagacggaagaatgagagccaaactcaccatccaggaaat
ttcaataaaatggtgtatgtcagttctgacagtacaccactctgcaacaagacacagtgc
caaaaagagccatggtcacctgtatccagtatgcaccaagactgcaggagatcaaagctc
attttaaatgatgggccacataatatagattacttcatgcaagaagctaaaaggaaaaag
cataaagcagatgcaatggtggagaaattcagcaaggcactgaattatgttgaagctgca
ttatcatttattgaatgtggaaatgccatggaacaaggacccacggagtctaagtctcca
tacacaatgtattctgaaacagttgaactcatcaggtatgctgtcagactaaaaacccac
tcagtccccagcgctactccagaagaaaaacaattagcaacattatgttatcgatgtttg
gcactcttatactggaggatgtttcgactcaaaagagaccatgctgtaaaatattctaaa
gcacttattgagtatttcaagaattcctcaaaaggtgcacaggcaccatccccatggggc
accagtggaaagcatactgggacaccttctcccatatcacccagcccatcccctgtgagt
tcagtggggtcccaggggagcacaggtgcaccttccccctcgtccattgtcagcatcccg
cagcgaatacaccagatggcggccaaccatgtcagtatcaccaacagcatcctacacagc
tatgactactgggagatggctgacaatcttgccaaggaaaaccaagatttctttaatgat
ttggatgccttgatgggacctgtcaccttgcacagcagtatggaccatttggtccaatac
actcaacaaggacttctctggatcaggagcagtgctcagttctcataa

DBGET integrated database retrieval system