KEGG   Anolis carolinensis (green anole): 100554306Help
Entry
100554306         CDS       T01608                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00052  Galactose metabolism
acs00500  Starch and sucrose metabolism
acs00520  Amino sugar and nucleotide sugar metabolism
acs00524  Neomycin, kanamycin and gentamicin biosynthesis
acs01100  Metabolic pathways
acs01200  Carbon metabolism
acs04910  Insulin signaling pathway
Module
acs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100554306 (gck)
   00052 Galactose metabolism
    100554306 (gck)
   00500 Starch and sucrose metabolism
    100554306 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    100554306 (gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100554306 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100554306 (gck)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100554306 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100554306
NCBI-ProteinID: XP_003224263
Ensembl: ENSACAG00000011822
Position
Un
AA seq 465 aa AA seqDB search
MLDHRARMDSSKKEKVEQILSEFQLREEDLKKVMRRMQKEMDRGLKLETHQEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWTVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMQN
VELVEGNEGRMCVNTEWGAFGASGELDEFLLEYDHVVDETSLNPGQQLYEKIIGGKYMGE
IARLVLLKLVNENLLFNGEASEKLKTRGSFETRLISQVESDPGDRKQIYNILTSFGLLPS
ATDCDIVRMVCERVSTRAAQMCSAGLAGVINRMRDSRSEETLKITVGVDGSVYKLHPSFK
DRFHTTVRQLTPGCDITFLQSEEGSGRGAALISAVACKMACMISQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcacagagctaggatggacagctccaagaaggagaaggtggaacaaatcttg
tcagaattccagctacgagaagaggatctgaaaaaggtgatgcgccggatgcaaaaggaa
atggaccgagggctaaagctagagactcaccaagaagcctctgtaaagatgctgcccact
tacgtgcgctctactcctgagggatcagaggttggagattttctatctttggatcttggg
ggaaccaattttcgagttatgctggtaaaagtgggcgaaggtgaagaaggacagtggact
gtgaagacaaagcaccagatgtattcaatcccagaagatgccatgacaggaacagctgaa
atgctcttcgattatatctcagaatgcatctctgacttcttagacaaacatcagatgaaa
cacaaaaagctacctctgggtttcacattttccttccctgtacggcatgaagacattgac
aaggggatcctactgaactggactaaaggtttcaaagcatcaggcgcagaagggaacaat
gttgtggggcttctgagagatgctattaaacggcgaggggactttgagatggatgtggtt
gcaatggtcaatgacacagtggcaacaatgatatcctgctactatgaggatcaccgatgt
gaagttggcatgatagtgggcacaggttgcaatgcttgttacatggaggagatgcagaat
gttgagctggtggaagggaatgaaggtcgaatgtgtgtcaacactgaatggggagccttt
ggggcatccggagaactggatgagttcctcttggagtatgatcatgtggtggatgagacc
tcgcttaaccccggtcagcagctgtatgagaagattataggagggaagtacatgggtgaa
attgcacgactagttctgctaaaacttgttaatgaaaatttgctcttcaatggagaagct
tcagagaagctgaaaaccagagggtcatttgaaacacgtttaatttcccaagttgaaagt
gatcctggtgaccgtaagcagatctacaacattctgacatcctttgggcttttgccctca
gcaacagactgtgacattgttcgtatggtatgtgagagagtttcaacacgggctgcacag
atgtgttcagcagggctggctggtgtcatcaaccggatgagagacagcagaagtgaggag
acactaaagatcactgtaggcgtggatggttcagtctacaagctccatcccagcttcaaa
gaccgattccatacaacagtccgacaactgacaccaggctgcgacatcacattcctgcag
tcggaggaaggcagtggcagaggggccgctctcatctctgcagtagcatgcaaaatggcc
tgcatgatcagccagtga

DBGET integrated database retrieval system