KEGG   Anolis carolinensis (green anole): 100554402Help
Entry
100554402         CDS       T01608                                 

Gene name
cxcr1
Definition
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04060  Cytokine-cytokine receptor interaction
acs04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100554402 (cxcr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100554402 (cxcr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:acs04030]
    100554402 (cxcr1)
   04050 Cytokine receptors [BR:acs04050]
    100554402 (cxcr1)
   04090 CD molecules [BR:acs04090]
    100554402 (cxcr1)
G protein-coupled receptors [BR:acs04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100554402 (cxcr1)
Cytokine receptors [BR:acs04050]
 Chemokine receptors
  CXC Chemokine
   100554402 (cxcr1)
CD molecules [BR:acs04090]
 Proteins
  100554402 (cxcr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Srg 7TM_GPCR_Sru
Motif
Other DBs
NCBI-GeneID: 100554402
NCBI-ProteinID: XP_003214998
Ensembl: ENSACAG00000001076
UniProt: G1K910
Position
1
AA seq 359 aa AA seqDB search
MEDTWTFDGNLYDLFGNYNYVYENTIDPSGVSEPCRAEAASPVIRYFVAFLYCLVCLLSL
IGNALVVLVVAYNKRNRSVTDVYLLNLAIADLLFALTLPIWAVFRAHEWIFGTGMCKFTS
VLKEVNFYSGVLLLAFISVDRYLAIVYATRHATEKRHWVKFVCVGIWVFSLLLSLPMVTY
REVFHAPNSSLRVCYENIGGNETSKWRVVLRILPQTFGFLVPLAIMLFCYGVTVHRLFQM
KNNQKKKAMKVILVVVLVFLFCWLPYNITLFADTLMRTGVITEDCKRRGIIDAGLSGTEI
LGFSHSCMNPIIYAFIGQKFRNNFLKILVERGIISKEVLIRYRKGSSFSSTSGNTSTTL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaagatacctggacatttgatgggaatttgtatgatctctttggaaattataattat
gtttatgaaaatacaatcgatcctagtggtgtgtcagaaccctgcagagctgaggctgca
tcgcctgtgatcaggtactttgtggccttcctctattgcctggtgtgcttactcagcctg
atagggaatgccttggtggttttggtggttgcctacaacaaacggaatcggtctgtgact
gatgtgtacctcctgaacctagccattgccgacctcctctttgccctcaccttgcccatc
tgggctgtcttccgtgctcatgagtggatctttggcactggcatgtgtaaattcacttct
gtcctgaaggaagtcaatttctacagcggagtcctcctgttggctttcatcagtgttgat
cgctacctggcaatagtgtatgctacccgtcatgcaactgaaaagaggcactgggttaaa
tttgtctgtgttggcatctgggtgttctctcttctcctttcactgcctatggttacctac
cgtgaagttttccatgcacctaattcctctttgagagtttgttatgagaatattggaggc
aatgaaacatctaaatggagagtggtgctgagaatcttgcctcaaacatttggcttcctt
gtgcctttggccatcatgcttttttgctatggggtaacggtgcatagactctttcaaatg
aagaacaatcaaaaaaagaaagctatgaaagtcatcctggttgtggtgctggtcttcctc
ttttgttggctgccttacaacatcaccctatttgctgataccttgatgaggactggggtt
attactgaggattgtaaacgccgtggtatcattgatgctggtctttcaggcacagagatc
ctggggttttctcacagctgtatgaatcccatcatctatgcctttatagggcagaagttc
cggaataacttcctcaagatcctggttgagagaggcatcatcagtaaagaagtcctgatt
cggtatcggaaaggctcttccttctcatctacatctggcaacacctccacaactctataa

DBGET integrated database retrieval system