KEGG   Anolis carolinensis (green anole): 100554615Help
Entry
100554615         CDS       T01608                                 

Gene name
gucy1a2
Definition
(RefSeq) guanylate cyclase 1 soluble subunit alpha 2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00230  Purine metabolism
acs01100  Metabolic pathways
acs04270  Vascular smooth muscle contraction
acs04540  Gap junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100554615 (gucy1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100554615 (gucy1a2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100554615 (gucy1a2)
Enzymes [BR:acs01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100554615 (gucy1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 100554615
NCBI-ProteinID: XP_003219350
Ensembl: ENSACAG00000011056
Position
3
AA seq 732 aa AA seqDB search
MSRRKISSESFSSLGSDYLETSPEEESECPVARLCWNGSRSPPSRSGDATPAAPPAERDP
GAATASGPAIPASGGSRRAPRRRRVNLDSLGESISRLTAPTPQTIRQTLQRTLQHYEHQV
MGYRDAEKNFHNISDRCSYTDHSGNDETEDVSGILQCTANILGLKFEELQEKFGAEFFNI
CFDENERVLRAVGGTLQDFFNGFDALLEHIRTSVGRQATLESSSFLCKELPGGSLLLHYF
HPHQIVSFAMVGMVKEAARKIYQLEVEVEQIATDKLGPEDLNPGNCSCLTFIIKEHENAN
ITKPLPLGTSQSPSDLRISINTFCRAFPFHLMFDPSMLVLQLGEGLRKQLKCDAHKNLKF
QDCFEIVSPKIGATFERVLLRLSTPFVIRTKLEASGSESKDKVMEIKGQMIHVPESNSIL
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLEKTH
QALEEEKKKTVDLLISIFPEEVAQQLWQGKQVPARKFDDVTMLFSDIVGFTAVCAQCTPM
QVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRQNLNHAKPIALMALKMMELS
EEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRVNVSP
TTYQLLKKEENFVFIPRSREELPDNFPKEIPGICYFLEVRTGQKQPKSSVTSARVRKISY
NIGTMFLRETSL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcgcaagatctcctcggaatccttcagctcgctgggctcggactacctggag
acgagccccgaggaggagagcgagtgcccggtggcccggctctgctggaatggcagccgc
agccccccgagccgctccggggacgccacgcccgccgccccgccagccgagagggacccc
ggagcagccacggcctcgggcccggccatccccgcctcgggaggctcccgccgcgctccc
cgccggaggagggtcaacctggactccctgggggagagcatcagccgcctcaccgccccc
acgcctcagaccataaggcagacactccagaggacactgcagcattatgagcatcaagtt
atgggttacagggatgctgaaaagaacttccacaatatctctgaccgatgctcctataca
gaccactctggcaatgacgaaactgaagatgtctcaggaattctccagtgtacagcaaac
atactcggcttgaaatttgaagaactgcaagaaaaatttggtgcagaattcttcaatatc
tgctttgatgagaatgagcgggttctccgagcagtgggtggcactttgcaagatttcttc
aatggctttgatgctttgttggagcacatcaggacttccgttggaaggcaggccactttg
gaatcatcttctttcctatgcaaagagctccctggaggcagccttctgctccactacttc
caccctcatcagattgttagttttgctatggtgggtatggttaaggaagcagcaagaaag
atctaccagctagaagtggaagtggaacaaattgcgacagataaactgggcccagaggac
ttaaacccaggcaactgcagctgcctcacttttattatcaaagagcacgagaatgcaaat
atcacaaaaccacttccacttgggacatcgcagtccccctcggacctgaggataagcatc
aacaccttctgccgagctttccctttccacttgatgtttgatcccagcatgctggtactg
cagctaggggaaggactaagaaagcaactcaaatgtgatgctcacaagaacctgaagttt
caagactgctttgagatcgtttctccaaagattggggccacatttgagcgagtccttctg
aggctgtcaacaccttttgtgatccgaaccaagctagaagcatctggctctgaaagcaaa
gataaggtaatggaaatcaaaggacaaatgatccatgtcccggaatcaaactccatattg
tttttgggttcaccttgtgtggacaaactggatgaactgatgggtcgtggtctccacctt
tcagacataccaatccatgatgctactcgtgatgtcattcttgttggggagcaggccaag
gcccaggatggcttaaagaagcggatggacaaactgaaggcaacactagagaaaacacac
caagctctggaagaagaaaaaaagaaaacagtggatctcctgatttctatcttcccagaa
gaagtggcccagcagctgtggcaagggaagcaagttccagcaaggaagtttgatgatgtt
accatgctcttctctgacattgttggcttcactgctgtctgtgctcagtgcactcccatg
caggtgatcagtatgctcaacgagctctacacacgatttgaccatcagtgtggattcctg
gatatctataaggtggaaacaataggtgatgcatattgtgttgccgcaggactccatagg
caaaacctgaatcatgcgaagcccatagccctgatggccctgaagatgatggagctctca
gaggaggtgctcacaccagatggaagacctattcagatgagaataggaattcactcaggt
tctgttcttgctggagttgttggcgtaagaatgccaaggtattgtctttttggtaacaac
gttaccctagcaagcaaatttgagtcgggaagccatcctcgtcgtgtcaatgtcagccct
accacataccagcttctgaagaaggaagaaaattttgtcttcattcctcggtcccgtgaa
gagcttccagataactttccaaaggaaatccctgggatttgttatttcctggaggtcaga
actggtcagaagcagccaaagtcctctgtcacatctgccagagtgagaaagatttcctac
aacattggcaccatgttcctccgggaaaccagcctatga

DBGET integrated database retrieval system