KEGG   Anolis carolinensis (green anole): 100554859Help
Entry
100554859         CDS       T01608                                 

Gene name
syk
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100554859 (syk)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100554859 (syk)
Protein kinases [BR:acs01001]
 Non-receptor tyrosine kinases
  SYK family
   100554859 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase Cbl_N3 GrlR RIO1
Motif
Other DBs
NCBI-GeneID: 100554859
NCBI-ProteinID: XP_008101325
Ensembl: ENSACAG00000000768
UniProt: G1K8U5
Position
2
AA seq 634 aa AA seqDB search
MANAHSISHLPYFFGNITREEAEDYLIQCGLSNGLYLLRQSRNYLGGFALSLVHDSKVYH
YTIEREISGSYAISGGKSHRSPVELINYHSDEVDGLVCLLKKSCNRPPGVEPKTSQFEDL
KENLIREYVKRTWNLQGHALEQAIISQKPQLEKLIATTAHLKMPWFHGMISREESEQRVH
LGTKTNGKFLIRERDNNGSFALCLLNEGKVLHYRIDKDKKGKLSIPDGKKFDTLCQLVEH
YSYKADGLLRIITDPVPNPNFHLTNGQSDFGNTPELPKRSTNKTWSTGGIINRIKSYTFP
RPGSQKSVFPVPGRSADSQLFNDYVPRRKRVQCADDQREALPMDTEVYESPYADPEEVKA
KNVTLDRSLLILEDQELGSGNFGTVKKGTYEMKKGKKVVAVKILKNESNDPSVKDELLRE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLMKHKDVTDKNIIELVHQVSM
GMKYLEENNFVHRDLAARNVLLVTQHYAKISDFGLSKALGSNDYYKAERYGKWPVKWYAP
ECMNFFKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGGEVAQMLERGDRMECPPGCPPEV
YELMKLCWTYNVDDRPAFSSVELRLRNFYYDIAQ
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgctcattctattagccacctcccctacttctttggtaacatcactcgtgag
gaagctgaggattatttgattcaatgtggattaagcaatggactgtatctactgcgacag
agccgaaactatcttggaggctttgctttgtccctggttcatgacagtaaagtttatcat
tacacaattgaaagggaaattagtggctcttatgccatttcaggaggaaagtcccacagg
agtcctgtagaactcattaactaccactcagatgaagtagatggtcttgtttgcctactc
aaaaaatcatgtaatcgcccaccaggagtggaaccaaaaaccagtcagtttgaagactta
aaagagaatcttatcagggaatatgtcaaacgaacttggaacttacaggggcatgctctt
gagcaagcaattattagtcagaaaccacagctagagaaattgattgcaacaacagcacat
ttgaagatgccctggttccatgggatgatatctcgtgaggaatcagagcaacgggtccat
ctggggacaaagactaatgggaaatttttgatcagggaaagagataacaatggatccttt
gctctctgcctcctcaatgaaggaaaggttttacattatcgcattgataaagacaagaag
ggaaagctctcaatcccagacggaaagaagtttgatactctctgccagctcgtggaacat
tattcctacaaagcagatggccttctaagaataatcactgatccagttccaaatccaaat
ttccacttaacaaatggacaatctgattttggcaacacaccagaacttcctaaacggtca
actaataagacttggtcaacaggtggaattatcaacagaatcaaatcatacactttccca
aggccaggaagccaaaagtcagttttccctgttcctggccgaagtgctgattctcaatta
ttcaacgactacgttccacgaaggaagcgagttcaatgtgcagatgatcaaagggaagct
ttgcctatggacacagaagtctatgaaagtccatatgctgatccagaagaagttaaagct
aaaaatgtcactcttgacagaagtctgctgattctggaagatcaggaacttggttctggt
aattttggcactgtaaaaaaaggcacctatgaaatgaaaaaggggaaaaaggtagtggct
gtaaaaattctcaagaatgaaagtaatgatccctctgtaaaagatgaactgctgagagaa
gcaaatgttatgcaacaactggataacccatatattgtccggatgattggtatttgcgaa
gctgagtcctggatgttggtaatggagatggctgaacttggcccgttgaataagtatttg
atgaaacacaaagatgtcacagacaagaacattatagagcttgttcatcaagtttctatg
ggaatgaaatatctggaagaaaacaactttgtgcatagagatctagctgcaagaaatgtg
ttactagttacccaacattatgccaaaatcagtgattttggactttctaaagctcttggc
tctaatgattattacaaggcagaacgttatgggaaatggccagtcaagtggtatgctcca
gaatgcatgaacttcttcaaattttcaagcaagagtgatgtctggagttttggtgtgcta
atgtgggaggcgttttcatatggtcaaaagccatacaagggtatgaaaggaggggaagtt
gctcagatgcttgaaagaggagacagaatggaatgtcctccaggttgcccgcctgaggtc
tatgaattaatgaaactgtgttggacatacaatgttgatgatcggccagcattttcgtca
gtggaattaaggctgcgcaacttctattatgacattgcacaataa

DBGET integrated database retrieval system