KEGG   Anolis carolinensis (green anole): 100555031
Entry
100555031         CDS       T01608                                 

Gene name
lins1, lins
Definition
(RefSeq) lines homolog 1
  KO
K22533  protein Lines
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    100555031 (lins1)
SSDB
Motif
Pfam: LINES_N LINES_C
Other DBs
NCBI-GeneID: 100555031
NCBI-ProteinID: XP_008117548
Ensembl: ENSACAG00000009809
UniProt: H9GFN0
Position
Un
AA seq 769 aa
MMGTPFFLLGQMYNDVLADGPLPTDNHECAALLDPYVSDLSGENKKLCLFSLEPDIQKST
LDSLAFKVDDESENENQSRHQTEEVTLLQLTLIKMILAKMQSQKLAVGIKCKYLEIVRIL
LEEAHIDSKLIHFVCSSDKQLSYLASKALVSLVCFQLKEEHLLNNAWLAFSSEALLGFPS
GDWITECLSTLTNMIKEILKDEGFCKRGDLKMVLMPLDEILKGFYDSVMFCYSDIPQDYP
ISAKATNDLSSFLDVLELLVASRIQLPLNLSCQRMLFLNASFILGLATAPVHDFIKKKSI
VLLKKCILHKAGEDLIKRKMPPSSYQDSYISADTSVLAGAVLQSVNSGWLNRLIVSEKSS
HFGGTLVKPEESPCSSADQVTLGALSLVFLKALEIKILDSEAETQVHLENVMSPLLMFLK
RYLRPSACVHPLGHLCMWLSVLFIEQDDDLFEASKALLTIHVKIERVWHDIGSTASHLDY
ETWTHQNGCNPHCIFLFLLKSIAFDATVLLDFLISSETCFLEYFVRYLKLLVENWHQFVQ
ICRFLKPTAYGDTGFPLLSQRKGSYHFDSSLQSDSCDPQPCTVMLLTTSTKLSSSWPMDS
QSARATRTTLLQGFDNTSLLEPLQRLVDYESSDDSETECIGEECLAETEQQSLNHQSCPD
ESNIMEVDDEAGASKQTVLFLDHENVNAASTSGCQISPDILGSEEEMLQKSVKCFQELQV
LVSKLYKRNLFPYNPNALLKLLTQIAAVSKAYKSKDIQCRHPNVSPPTC
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgatggggactccttttttccttctggggcagatgtacaacgatgtgctggcagatggc
cctttaccaacagataaccatgagtgtgcagctctcctggatccttatgtttcagactta
tcaggagaaaacaagaaattgtgtctattttctcttgagcctgatatccagaaatctaca
ctagactctttggccttcaaggtggatgatgaatctgaaaacgagaaccagtcaagacac
cagacagaagaagttacgttacttcagttaaccttgatcaagatgatacttgctaaaatg
cagagccaaaaattggccgttggaataaaatgcaagtatcttgagattgttcgaatcctt
cttgaagaagcccacattgactccaaattaattcattttgtgtgcagttcggataagcag
ctctcctatttggcatccaaagccttggtctcccttgtatgttttcagctaaaggaagag
catttactgaacaatgcctggcttgctttttcctcagaggctttgttgggatttcctagc
ggggactggataacagaatgcctgtcaactcttacgaacatgataaaagagattttgaaa
gatgagggcttctgcaaaagaggagacttgaagatggttctgatgccacttgatgagata
ctcaaaggcttttatgactctgtcatgttttgttattctgacatcccgcaagattatcct
atctctgcaaaagccacaaatgacttgagcagttttctagatgtccttgaactgcttgtg
gcctctagaattcagctgccactgaacctttcctgccagcggatgttgtttttgaacgct
tccttcattttgggccttgccactgcgcctgttcatgacttcatcaagaaaaagtcaatt
gttttgcttaaaaaatgcattcttcacaaagctggtgaagacctaataaaaagaaaaatg
cctccttcctcctaccaggattcttatatcagcgcagatacatcagtgcttgctggtgct
gtcctgcagtctgtgaattctgggtggctgaacaggctgattgttagtgagaagagcagc
catttcggaggcacactagttaagcctgaagagagtccctgtagcagtgctgatcaagtg
actctcggagccttaagcctggtttttctgaaagcattagagataaaaatcctggattct
gaagctgaaacccaagttcatttagagaatgtcatgtctccattgctgatgttcttaaaa
agatacctgaggccttctgcttgtgtccacccattggggcatctctgcatgtggctttct
gtgctgtttatagaacaagacgatgacctgtttgaagcttcaaaagccttattaacaatt
catgtaaagattgagagagtctggcatgacattggttctactgcgtcccatttggattat
gaaacgtggacacatcagaacggctgcaacccacactgtatctttttatttctcctaaaa
agtattgcgtttgatgctaccgttcttctcgatttcttgatttcatccgaaacctgtttc
ctggagtattttgtaagatacctaaagttacttgtagaaaactggcaccagtttgtgcaa
atatgtaggttccttaagcccacagcctacggagacactggttttcctctgttatcccaa
cgtaaaggaagttaccacttcgactcaagtttacagagtgattcctgtgatccacagccc
tgcactgtgatgcttttgaccacttccacgaaactttcttcatcttggccgatggacagt
cagtctgcaagagctaccaggactaccttgttgcaagggtttgacaacacatctttattg
gaaccccttcagcgtctggttgactatgaaagctcagatgattctgagacagaatgtata
ggagaggagtgtttggccgaaacagaacagcagtctttgaatcatcaatcgtgtccagat
gaaagtaacattatggaagtggatgatgaagctggagcctcaaagcaaactgtattattt
ctggatcacgaaaacgtgaatgctgcttcaacctctggctgccaaatatccccagacatt
cttgggtctgaggaagaaatgcttcagaaatccgtaaaatgtttccaagagcttcaagta
ttggtttctaaactatacaaaagaaacctgtttccgtacaatccaaatgcgctcctgaag
ctcttgacccaaattgcagcagtcagcaaagcatacaagtctaaagacatacaatgccga
catcctaatgtatctccacccacttgttag

DBGET integrated database retrieval system