KEGG   Anolis carolinensis (green anole): 100555619Help
Entry
100555619         CDS       T01608                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100555619 (minpp1)
   00562 Inositol phosphate metabolism
    100555619 (minpp1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100555619 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100555619 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100555619
NCBI-ProteinID: XP_003224432
Ensembl: ENSACAG00000015245
Position
Un
AA seq 452 aa AA seqDB search
MACRLLLLLLLLGSAAAQRASDLASYFGTKSRYETIHPHLLADPFSLGPPERGFPLPTAT
CEPIHLRALVRHGTRFPTRKQIEKLDRLHKELVHRRSVGPACRAADSLAGWKMWFRPEMD
GRLAGRGRRDMSALARRLAARIPGLFSARNHLAFASSSKPRCLDSAAAFREGLRQAGHSA
PADGRLKESFEVNDKLMRFFDHCEKFVKGVENNSTALREMDVFRDGPEMRSVVDKITRTL
CLPAKRLDADLIQVAFFTCSFGLTIKNINSPWCALFNTDDAKVLEYLNDLKQYWKRAYGH
DINSRSSCNLFQDIFKHLDQAVSESKSSRAISSPVMLQFGHAETLLPLLALMGYFRDTEP
LKADNYAKQAGRQFRSGRIVPYASNLLFLLYHCEKASSPEEKYKVQILLNERLLVFPHSG
ETVASYSSLKNHYKALLENCHFNEVCALTKTG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgccgcctgctcctcctgctgctcctcctgggaagcgcggcggcgcagagggcc
tcggacctggcctcctacttcgggaccaagtcgcgctacgagaccatccacccgcacctg
ctggccgaccccttttcgctggggccgcccgaacggggcttcccgctgcccacggctacc
tgcgagccgatccacctccgcgccctggtccgccacggcacccgcttccctactcggaag
cagatcgagaagctggaccgccttcacaaggagctcgtccaccgtcgcagcgtcggccca
gcctgccgcgccgccgatagcctggccggctggaagatgtggtttcggcccgagatggac
gggcgcctggccggcagggggcgccgagacatgagcgccttggcccgccgcctcgccgcc
cgcatccccggcctcttctccgcccggaaccacctcgccttcgccagcagctccaagccc
cgctgcctcgacagcgccgccgccttccgagaggggctccggcaggccgggcattccgcc
cccgccgacggcagactgaaagaaagctttgaagttaatgacaaactgatgcgatttttt
gatcactgtgaaaagtttgtcaaaggtgtagaaaacaacagcacggctttgcgtgagatg
gatgtatttagagatggtcctgaaatgaggtcagtagtggataaaattacaagaaccctg
tgtttaccagcgaaacgcctagatgcagatttgattcaggtggcattttttacttgttcc
tttgggctaacgataaaaaatatcaactccccctggtgtgcactcttcaatacagatgat
gccaaggtacttgaatatctgaatgatctaaagcagtattggaagagagcctacggacat
gatatcaacagccgctccagctgcaatcttttccaggatatcttcaagcatttggaccaa
gctgtttcggagagtaaaagttccagggctatatcctcccctgtgatgctacagtttgga
catgcagagaccctactgccgctccttgctctgatgggatacttcagagatacggagccc
cttaaagcggacaactacgccaagcaagcaggccgtcagtttcgcagtggccgcattgtc
ccttacgcctcaaatctgttgtttctgctttatcactgtgagaaagccagttcaccagag
gagaaatacaaggttcaaatactgctcaatgagaggctgcttgtatttccacattcgggg
gagacagttgcttcatatagcagcctgaaaaaccattacaaagctctccttgaaaattgc
cacttcaatgaagtctgtgctttgacaaagactggttaa

DBGET integrated database retrieval system