KEGG   Anolis carolinensis (green anole): 100555818Help
Entry
100555818         CDS       T01608                                 

Gene name
creb1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04261  Adrenergic signaling in cardiomyocytes
acs04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100555818 (creb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100555818 (creb1)
Transcription factors [BR:acs03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100555818 (creb1)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100555818 (creb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf DUF4988
Motif
Other DBs
NCBI-GeneID: 100555818
NCBI-ProteinID: XP_008116978
Position
Un
AA seq 315 aa AA seqDB search
MTMESGADNQQSGDAAVTEAENQQMTVSMPAGHGTSSAPTVTLVQLPNGQTVQVHGVIQA
AQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAP
GVPRIEEEKSEEEAAAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQT
LTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGV
VMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLI
EELKALKDLYCHKSD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggtgcagacaaccagcagagtggagacgcagctgttacagaagca
gaaaatcaacaaatgacggtatctatgccagcaggtcacggaacatcttctgctcccact
gtaaccttagtacagctccccaacgggcagactgttcaagtccatggtgttattcaggct
gcccagccatcggtgattcagtctccacaagtccagacagttcagatatccaccattgca
gagagtgaagattcacaggaatcagtagacagtgtcacagactcccagaaacgcagggaa
attctctccaggcgaccttcgtacagaaaaatcttgaatgacttgtcctcagatgccccg
ggtgtgccaagaattgaagaagaaaagtctgaagaggaagcagcagcacctgccatcact
actgttacagtgccaactccaatttaccaaacaagcagtgggcaatacattgctattacc
cagggcggtgcaatccagttagccaacaatggcacagatggagtccagggcctgcagaca
ctgaccatgaccaatgctgctgcaacccagcctggtaccaccattttacagtatgcccag
accacagacggacaacagattcttgtacccagcaaccaagttgttgtacaagctgcctca
ggagatgtccagacttaccaaatccgcactgcacccacaagcaccattgcccctggtgtt
gtcatggcatcgtccccagcccttcccacccagcctgcagaggaagcagcacgaaagagg
gaagtccgtctaatgaagaacagggaagcagcacgcgagtgccgccggaagaaaaaggaa
tatgtcaaatgtctagaaaacagagtggctgtgcttgaaaaccaaaacaagacattgatt
gaagaactgaaagcacttaaggacctttattgccacaaatcggattaa

DBGET integrated database retrieval system