KEGG   Anolis carolinensis (green anole): 100555877Help
Entry
100555877         CDS       T01608                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04114  Oocyte meiosis
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04350  TGF-beta signaling pathway
acs04370  VEGF signaling pathway
acs04371  Apelin signaling pathway
acs04510  Focal adhesion
acs04520  Adherens junction
acs04540  Gap junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04916  Melanogenesis
acs04933  AGE-RAGE signaling pathway in diabetic complications
acs05132  Salmonella infection
Module
acs_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100555877 (mapk1)
   04012 ErbB signaling pathway
    100555877 (mapk1)
   04350 TGF-beta signaling pathway
    100555877 (mapk1)
   04370 VEGF signaling pathway
    100555877 (mapk1)
   04371 Apelin signaling pathway
    100555877 (mapk1)
   04068 FoxO signaling pathway
    100555877 (mapk1)
   04150 mTOR signaling pathway
    100555877 (mapk1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100555877 (mapk1)
  Cell growth and death
   04114 Oocyte meiosis
    100555877 (mapk1)
   04210 Apoptosis
    100555877 (mapk1)
   04218 Cellular senescence
    100555877 (mapk1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100555877 (mapk1)
   04520 Adherens junction
    100555877 (mapk1)
   04540 Gap junction
    100555877 (mapk1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100555877 (mapk1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100555877 (mapk1)
   04621 NOD-like receptor signaling pathway
    100555877 (mapk1)
   04625 C-type lectin receptor signaling pathway
    100555877 (mapk1)
  Endocrine system
   04910 Insulin signaling pathway
    100555877 (mapk1)
   04912 GnRH signaling pathway
    100555877 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    100555877 (mapk1)
   04916 Melanogenesis
    100555877 (mapk1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100555877 (mapk1)
   04270 Vascular smooth muscle contraction
    100555877 (mapk1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100555877 (mapk1)
  Infectious diseases
   05132 Salmonella infection
    100555877 (mapk1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100555877 (mapk1)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100555877 (mapk1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100555877 (mapk1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100555877 (mapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kinase-like FTA2 Choline_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 100555877
NCBI-ProteinID: XP_003225163
Ensembl: ENSACAG00000001402
UniProt: H9G541
Position
Un
AA seq 368 aa AA seqDB search
MAAVSGAAGGSGANPAGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVA
IKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTTDQMKDVYIVQDLMETDL
YKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKVCDFGLAR
VADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH
YLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPYKNKVPWNRLFPNADAKALDLLDK
MLTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETA
RFQPGYRC
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtttcgggggcagccgggggcagcggggccaaccccgccgggggccccgag
atggtccgcgggcaggccttcgacgtgggaccccgctacaccaacctctcctacatcggc
gaaggggcctacggcatggtctgttctgcctatgacaatgtcaacaaagttcgggtggca
ataaagaagatcagcccttttgaacaccagacttactgccagaggactctgcgagaaatc
aaaatcctcttgcgtttcaagcatgaaaatattattggcatcaatgacattatcagagct
ccgacaactgatcaaatgaaagatgtatacattgtgcaagatctcatggagacagacctt
tacaagctcttaaagacccagcatctcagcaatgatcacatctgttatttcctttatcaa
atcctgagaggattgaaatatatccattcagccaatgtgctgcaccgtgacctcaagcct
tccaacttgctgctgaacacaacttgcgatcttaaggtctgtgactttgggttggctcgc
gttgcagatcccgatcatgaccacactggcttcctcaccgagtatgtggccacgcgttgg
tatcgagctcctgagattatgttgaattcaaagggctataccaaatctattgacatttgg
tcagtaggctgtattttggcggaaatgttatccaacagacccatctttccagggaaacac
tatctcgatcagctgaaccacattctgggaatacttgggtctccttctcaagaagaccta
aactgtataatcaatttgaaagctagaaactatttgctttctctaccgtacaaaaacaaa
gtgccgtggaacaggctgtttccaaatgctgacgccaaagctcttgatttgttggataag
atgttaaccttcaaccctcataaaagaattgaagttgaagaagctttggcccatccatat
ctagagcagtattacgatccaagtgatgagcctgtagcagaagcacctttcaaatttgac
atggaactagacgacctgccgaaggaaaagcttaaagaacttatttttgaggaaactgcc
agattccagccgggatacagatgctaa

DBGET integrated database retrieval system