KEGG   Anolis carolinensis (green anole): 100557346
Entry
100557346         CDS       T01608                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00230  Purine metabolism
acs00240  Pyrimidine metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100557346
   00240 Pyrimidine metabolism
    100557346
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100557346
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 100557346
NCBI-ProteinID: XP_016847244
Position
2
AA seq 311 aa
MYPPPKRLCLSPQGSLDNSFRNAFKEISLGGNVAAGKSTFVQLLEKYSDEWEVIPEPIAK
WCNIQTTENEHQELSTSQKSGGNLLQMLYGKPTRWAYTFQTYACLSRVKAQLKPVSAKLH
EAEHPVQFFERSVYSDRYVFASNLFESGDINETEWAIYXDWHAWLLNQFDSNLELDGIIY
LRTTPEKCMERLMRRGREEEQGIELEYLENLHYKHETWLHERTMKVDFDNLKDIPTLVLD
VNDDFKNDEIKQEHLLEKVCISIVFKSVCCCSVNILYLEQSPQEPDPNGLLISIFAWSWL
ACFKIQTFVHD
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtacccgccgcccaagcgcctctgcctcagcccccagggctccctcgacaacagcttc
agaaacgccttcaaagagatttcgcttggagggaacgtcgctgcagggaaatctaccttt
gtccagctgctagaaaaatacagtgatgaatgggaagtaattcctgaacccattgccaag
tggtgcaacatccagacaactgaaaatgaacaccaagagctttcaacatctcagaagagt
ggaggaaatttgcttcagatgttgtatggcaaacctacaagatgggcttatacattccag
acctatgcctgtttgagtcgagttaaagcgcaattaaaaccagtttctgcaaaactccat
gaagcagaacatcctgtgcagttttttgagagatcagtgtacagcgataggtatgtattt
gcttccaatttatttgaatcgggagacatcaatgaaacagaatgggcaatttatncagac
tggcatgcatggcttctgaaccagtttgactccaacctggagttagatggtattatctac
ctccggacaacccctgagaagtgcatggagaggctaatgcggagaggcagggaagaagaa
caaggaattgagctggaatatctagaaaacctccactataaacatgaaacctggcttcat
gagagaacaatgaaggtggatttcgacaacctgaaagatatcccaactctggttttagat
gttaatgacgacttcaaaaacgatgaaataaaacaagaacatttgttggaaaaagtatgt
atctccattgtttttaaatctgtgtgctgctgttcagtaaacattttgtacttagaacag
tcaccgcaagaacctgaccccaatggattattaatcagcatttttgcatggtcttggcta
gcttgcttcaaaatccaaacttttgtacatgactaa

DBGET integrated database retrieval system