KEGG   Anolis carolinensis (green anole): 100557407Help
Entry
100557407         CDS       T01608                                 

Gene name
pik3c2a
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100557407 (pik3c2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100557407 (pik3c2a)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     100557407 (pik3c2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 100557407
NCBI-ProteinID: XP_003214851
Ensembl: ENSACAG00000000045
Position
1
AA seq 1698 aa AA seqDB search
MDICFHGMAQISGNNELRPCSSPSLGTAKAKEVDKEEALQMEAEALAKMQKERVVPGNRQ
SIDTLSKSWPNVQSCRKQDHDLMVFPESDAKKKMNDKLNTVDIEKLTRAELEKLLLEENL
ESSKPTTLPATPGLSPSFSSQFYANPTIQRGPWTPGLLGPAACTVPSNYAPPSFSKQVGI
FQNGFHPGLSTYQSTKPIYLSLPEGSQYISYTLPSTTTFHTQQSLPIFHPTLTPEMAKVF
DKIASTSEFQKNGRSSSDLEVTGAKSTINLPVPESSNDISKFDWLDLDPLSKPKGDSMEI
LYNAEDGGKVTCNTVVEDPWDAVLLEEKSPGKCHHERKLSGKSTSGATVTRSQSLNIRTA
QLAKLQGQTSQTDCGTTSLPTGNKLLKNVEGQNQEQAAFCEAIGKLRTKFPHKNHDTNPG
FVLSPVMLQRNISGENSSIKISIEIEGFQQPVTFTCDASSPVELIIMQALCWVHDDLNDV
DIGSYILKVCGQEEVLQNKHSVGSHEYIQNCRKWDSEIKLQLLTYNVICRDLARTADDDG
TQIDLIKHLSNVEKLFRESIQSHSLEELLEAYHNQVAIILKKEKQLKAVDPVIKAVRKIC
CTLDGVETPAITMAVKKLRRAVNLPRNKSPEVSSDDASKNTTGSLQTENPLQVSLDQLTS
AVYALLELHLNSCNSCSLNALETERSTKGAWTATEHLQFTVFAAHGILSGWVSVYEKYYL
VCSLTHNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESILCLTLFGILN
QNSGSSPDSNKQRKGPEMLGQVSFPLFDFRRILASGTKLLHVWTPSTSLVFGVAHKKGNL
MERIVLQVDFPSLPFDIIYKTPEAASGSTCNSIETLEKDSRERLITILSKQGTVGLSRKD
KAFLWEKRHYCHTDVNSLPKVLASAPNWDLTTLPEIYLLLQQWPPLPPLTALALLDSNFT
DQEVRTKAVKWIEAISDDELADILPQFVQALKYETYLDNSLVRFLLARALGNIRIAHYLY
WLLKDTLHDIKHGVMYEHILGAFLSVCGKRLREDLEKQTRLVQILGMVAEKVKQTNGSAR
QVVLQSGMERVQSFFLKNKCRLPLSPSLVAKELNVKACSYFSSNAVPLKIALVNSDPLGE
EINVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVLFKCLSTGKDRGMVELVPAAD
TLRKIQVENGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLGICDR
HNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQL
FVDLCCQAYNLIRKQADIFLSLLSLMLSSGLPELNGVQDLKYVQDALQSQTTDAEATILF
TRLIESSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSLKQDGRIKEASVFT
YHKRYNPDKHYIYVVRILREGQSEPTFIFRTFDEFQEFHNKLGILFPLWKLPGFPNKMVL
GRTHIKDVAARRKVELNSYMQSLMNASTDVSECDLVYTFFHPLLRDEKAEGIDGIAKCTD
ISPSSPVSGKVGGEVKLSISYRNSTLFIMVMHIKDLVTDDGADPNPYVKTYLLPDIHKTS
KRKTKISRKTRNPTFNEMLVYSGYNKETLKQRELQLSVLSAESLRENFFLGGVTLSLKDF
NLNKETINWHRLAAVPYL
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atggacatctgctttcacggcatggcccagatatctggcaacaatgaactcagaccatgt
tcatcaccatctttgggtacagcaaaggcaaaagaagtggacaaggaagaggcactacag
atggaggctgaggctctggctaagatgcaaaaggaaagagtggtgcctggaaatagacaa
agtattgacactttaagcaaatcctggccaaatgtacaatcctgccgaaaacaggaccat
gatcttatggtgtttccagagtcggatgccaagaaaaagatgaatgataaattaaataca
gtggacatagaaaaacttacccgtgctgaactggagaaactgctactagaggaaaatctt
gaatccagcaaaccaacaacactgccagcaactcctggtctgagtccatcgttctcgtca
cagttttatgctaaccctaccattcaaagaggaccgtggacacctgggttgcttgggcct
gctgcttgcactgtaccttctaattatgcgccaccttctttcagtaaacaagttggtatc
tttcagaatggcttccatccaggactgtccacttatcagtctacaaagcctatttatctt
agtcttccagaggggtcccagtacatttcatacacactgccaagtactacaacgttccat
acacaacaaagtctacctatatttcatccaacacttacccctgaaatggccaaagtgttt
gataagatagcaagcacttcagaatttcaaaaaaatgggagatcgagctctgacttagaa
gtgactggtgctaaatctacaattaatttgccagtccctgaaagctccaatgatatcagt
aaatttgattggttggatttggatcctttaagtaaaccaaaaggggacagtatggagata
ttgtataatgcagaagatggtggaaaagtgacctgtaatacagttgtagaagacccttgg
gatgctgtgcttttggaggagaaatccccaggaaaatgtcatcatgaaagaaaacttagt
gggaaatctacttctggtgcaacggttacaagaagtcagtctttaaacattcgaactgcg
cagcttgctaagttgcagggccaaacatcacagacagactgtgggaccactagcctgcca
acaggaaataaacttctaaaaaatgttgaagggcaaaatcaggaacaagcagcattctgt
gaagccattggaaagctaaggaccaagtttccgcataaaaatcatgatacaaacccaggt
ttcgttttgagtccagtcatgttgcaacgaaacatcagtggagaaaactcaagcatcaag
atttcaatagaaatagagggttttcaacagccagtgacatttacatgcgatgccagttct
ccagttgagctcataataatgcaggcactttgctgggtgcatgatgatttgaatgatgta
gacattggcagttatatcttgaaagtttgtgggcaagaagaagttttgcagaataaacat
agtgtaggaagccatgaatacatacagaactgccgcaaatgggactcagagattaaactg
cagctcctgacctacaatgttatatgccgagacctggcacgaacagctgatgatgatggg
acacaaatagatttgatcaaacatctgagtaatgtagaaaaactcttcagagaaagcatt
cagagccattctcttgaagagctcttagaagcttatcataatcaagttgctattattctt
aaaaaggagaagcagctcaaagcagtagatccagtcattaaagctgtcagaaagatttgt
tgtacattggatggagtagagactcctgccattacaatggcagtaaagaagctgagaaga
gcagttaatcttccacggaataagagtcctgaggtgtcttctgatgatgctagcaagaat
accactggttcattgcaaactgaaaaccctctacaagtgagcctagatcagttaacctca
gctgtctatgccctccttgaactccacttgaactcatgcaatagttgttctttgaatgct
ctagagactgagagaagcactaaaggggcttggactgccacagaacacctccagttcaca
gtatttgctgctcatgggattctcagtggctgggtctctgtttatgaaaaatactacttg
gtttgctctctgacccataatggaaaagatctttttaaacctgtccagtccaagaaagtt
ggaacatacaagaactttttctatttgattaaatgggatgaactgataattttccctata
cagatttctcagttgccattagaatccatcttatgccttactctctttgggatattaaac
caaaatagtggtagttcacctgactcaaataagcagcggaaaggcccagagatgttgggt
caagtttccttccctctctttgattttagacgaatattggcttctggaacaaaactctta
catgtttggacaccttccacaagccttgtttttggagtagcccataaaaaaggaaaccta
atggaaaggattgtgttacaggttgactttccttctttgccatttgatattatatacaaa
actcctgaagctgcaagtggctccacatgtaattccatagaaacattggaaaaagattca
agagaacgtcttattaccattctttccaaacagggtacagttggcctgtctagaaaggac
aaagcatttctgtgggagaaacgacattactgccatacagatgtaaatagccttccaaag
gttttagccagtgctccaaactgggatttgacaactctccctgaaatatatttgctgctt
cagcaatggcctcccttacctcctctgactgcattagcattactggactccaacttcaca
gatcaggaagtaagaacaaaagctgtaaagtggatagaggcaatcagcgatgatgaactg
gctgacattctaccccagtttgtgcaggcactgaaatatgaaacttacttggacaactct
ctagtcagattccttttggcccgagcattaggaaatattcgaatagcacactatttatat
tggttactgaaggatacccttcatgatattaaacatggtgtaatgtatgagcatatcctt
ggtgccttcctttcagtctgtggcaaaagactgagagaagatctggaaaagcagaccaga
ctagtacaaatactgggaatggttgcagaaaaagtaaagcaaacaaatggatctgccaga
caggttgtcttgcaaagtggaatggaacgtgttcagtcctttttcttaaaaaataaatgt
cgtttgccactcagtcccagccttgtagcaaaagaactgaatgttaaggcatgctcctac
ttcagttcaaatgcagtccctcttaaaattgctctagtgaattcagatcccttgggagaa
gaaattaatgtcatgtttaaggttggagaagatctacgtcaggacatgctggcattgcaa
atgataaaaattatggataagatttggttacaggaaggactcgatttgcggatggttctc
ttcaagtgcctttctactggcaaagacagaggaatggtggagcttgttccagctgcagac
acacttaggaaaattcaggtagaaaatggtgtgactgggtccttcaaagataagcctctt
gctgaatggctaagaaaatacaatcccacagaagaagaatatgaaaaggcttctgaaaac
ttcatctattcttgtgcgggatgttgcgtagccacctatgtccttggtatctgtgaccgc
cacaatgacaacataatgcttcgaagtacaggacatatgttccatattgattttggaaag
tttttgggacatgcacagatgtttggaagctttaagagggatcgggctccttttgtgctg
acatcagatatggcctatgttatcaatggtggtgaaaagcctacaattcgcttccagctg
tttgttgatctctgctgccaggcttataacctgataaggaaacaagccgacattttcctc
agtctgctgtcactgatgctatcctctgggttaccagaacttaatggcgttcaagacttg
aaatatgtccaggatgctcttcagtcccaaacaacagatgctgaagctaccattttgttt
acaaggctaattgaatccagcctgggaagtgttgctacaaagttcaatttcttcatccat
aatcttgctcagctgcgtttttcaggcctgccttccaatgatgagcccattctatctttt
tctcccaaaacgtattcacttaagcaagatgggcgtatcaaagaagcatctgtgtttaca
taccacaagagatacaatccagataaacattatatctatgttgtcagaattttaagagag
gggcaaagtgaacccacgttcatttttcggacttttgatgaattccaggaattccacaac
aagctcgggatcctgtttcctctgtggaaattaccaggtttccctaacaaaatggttcta
ggaagaactcacataaaggatgtagcagccaggaggaaggtagaactaaacagctacatg
caaagtttgatgaatgcctcaactgatgtatcagagtgtgatcttgtttatactttcttt
catcccttgctacgtgatgaaaaagctgaaggaattgatggaatagctaagtgtacagat
ataagcccttcaagtcctgtgtcaggcaaagtaggaggagaagttaagttgtccatctcc
tatagaaacagcactctgtttatcatggtgatgcacattaaagatctggttactgatgat
ggggcagacccaaatccctatgtgaaaacttacctgctcccagatatacataaaacatct
aagaggaagacgaaaatatcacggaagactagaaacccaactttcaatgaaatgcttgtg
tacagtggatataacaaggagacattgaagcaaagggagcttcagctgagtgtactcagt
gcagaatcgctgcgtgagaacttttttttgggtggtgtcactctttccttaaaggatttt
aacttgaacaaggagaccatcaactggcatcggcttgctgcagtaccatacttgtga

DBGET integrated database retrieval system