KEGG   Anolis carolinensis (green anole): 100557963Help
Entry
100557963         CDS       T01608                                 

Gene name
lamc1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04510  Focal adhesion
acs04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100557963 (lamc1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100557963 (lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF Laminin_B Death
Motif
Other DBs
NCBI-GeneID: 100557963
NCBI-ProteinID: XP_016850553
Ensembl: ENSACAG00000005133
Position
Un
AA seq 1602 aa AA seqDB search
MRPAVAAFPQLLLLLLLLVAARRCAGAMDECTEEEGGGGRAQRCMPEFVNAAFNATVVAT
NTCGRPPEEYCVQTGVTGVTKSCHLCDAAQPHLSHGAALLTDYNNQADATWWQSQTMLAG
AQYPSAINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWVPYQYYSGSCENTY
QKSNRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTA
TDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEYGKLSCN
CKHNTFGVDCEKCLPFYNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTGHGGH
CTGCFGNTDGPNCQRCRENFYRLGSEEVCLPCNCNPVGSLSTQCDNYGRCSCKAGVMGDK
CDRCQPGFHSLTEAGCRRCSCDPAGSTDECNMETGRCTCKDSVEGFNCERCKPGFFNLDS
SNLRGCTPCFCFGHSSVCTNANGYSIYRITSSFQIGEEEWHAEQRDGSEMSXWISETQEI
SVISDTPFPIYFIASGKFLGNQILSYGQNLTFSFRIDRRDTRLSAEDIILEGAGLRVSVP
LIAQGNSYPSENIVKYTFRLHEATDYPWRPSLTPFEFQKLLRNLTAIKIRGTYSERNAGY
LDDVTIVSARPGPGITATWVESCTCPTGYLGQFCEQCADGYRRETPSLGPYSPCVPCFCN
GHSETCNPETGACNCRDNTAGPHCEKCSDGYYGDATTGTSSDCQPCPCPGGSTCAIVPKT
KEVVCTNCPAGTTGKRCELCDDGYFGDPLGTNGPARFCRLCQCSDNIDPNAVGNCNRLTG
ECLKCIYNTAGFYCDRCKDGFYGNPLAQNPEDKCKACNCNPYGTMNVQTSCSQVTGQCEC
LPHVTERDCSSCEPGFYNLQSGRGCERCDCHPLGSTNGHCDIQTGQCECQPGITGQRCER
CEANHFGFGREGCKPCDCDPEGSRSLQCKDDGRCECKEGFVGNRCDQCEENYFYNRSWPG
CQECPACYRLVKDKVAEQRERLQELENLIANIGTGDETITDQAFEDRLKDAERDVMDLLR
DAQSIKDVDQGLMDRLHEINRTLSSQLGRLRNIQNTVDETENLAGQAQTRVDNTQELIET
ASNMLQRARMAVANVSITPPQSTGDPNNMTVLAEEARQLATRHKEEADDIVRIAKEANDT
SSQAYQLLLDTLSGENQTMDDINDLNRKYNQAKNISRDLERQANKVHAEAEEAGNKALQI
YANLTSLPSIDTDKLENEANKIKKEARDLDQLITRKLKDYEDLREDMKGKELEVQNLLEK
GKTEQQTADQLLARADAAKALAEEAAKKGKDTLQEANDILNNLNDFDKRVNDNKTAAEDA
LKKIPAITRTILEANNKTRQAEAALGSAAADAREAKNKAGDAEKIASSVQKNAAETKADA
DKTFSIVADLDKEVDDMLQQLEDAEKELKRKQESADQDMMMAGMASQAAQEAEDNARKAK
NSVNSLLSTINDLLEKLGSVEPVDSSKLNDIEDTLNAAKKQMRDNDLDQKVSDLEKAAEK
QASAISEYNRDISTIRKDIANLEDIKKTLPTGCFNTPSIEKP
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggctgtggcggcgttccctcagctgctgctgttgttgcttcttctggtggcg
gcgaggcgctgcgcgggcgccatggacgagtgcacggaggaggagggcggcggcgggcgg
gcgcagcggtgcatgccggagttcgtgaacgcggccttcaacgccacggtggtggccacc
aacacgtgcggccgcccccccgaggagtactgcgtgcagacgggcgtcacgggggtcacc
aagtcgtgccacctgtgcgacgccgcccagccccacctgagccacggcgccgccctcctc
accgactacaacaaccaggccgacgccacctggtggcagagtcagaccatgctggccggc
gcccagtaccccagcgccatcaacctcacactccacctcggaaaggcctttgatattacc
tatgtacggctgaagttccacaccagccgaccagagagctttgccatttacaaacggacc
cgggaagatggcccatgggtgccttatcagtattacagtggatcctgtgagaacacctac
cagaaatccaatcgaggctttatcaggactggggaagatgaacagcaggcactttgcaca
gatgaattcagcgacatctctccattgacaggaggcaatgtggccttttcaactttggaa
gggaggcccagtgcttataactttgataacagccctgtcttgcaggaatgggtaactgcc
actgatatcagggtgacactcaatcgcttgaacacctttggagatgaagtttttaatgat
cccaaagttctcaagtcctattattatgcaatttctgactttgctgtaggtggcaggtgc
aagtgcaatggccatgcaagtgagtgtatgaagaatgaatatggaaaactttcctgcaat
tgcaaacacaataccttcggggttgactgtgaaaagtgcctccctttttacaatgaccgg
ccttggcgacgagcaacggcagagagtgctagtgaatgtttgccctgtaactgcaatgga
cgatcacaggagtgttattttgatcctgagctgtaccgttccaccggtcatgggggccac
tgcaccggctgctttggtaacacagatggaccaaactgtcaaaggtgccgggagaatttc
taccgtcttggcagtgaagaagtgtgtctaccatgcaattgcaatcctgttggctccctc
agcacacagtgtgacaactatggacgatgcagttgtaaagctggtgtgatgggtgacaaa
tgtgacagatgtcagcctggtttccattctctcacagaagctggttgcaggcggtgctcc
tgtgatcctgctggcagcacagatgagtgcaatatggaaacgggacgttgcacttgtaag
gacagtgtggaggggttcaattgtgagaggtgtaaacctggctttttcaacctggattcc
agcaaccttaggggatgtactccttgcttctgttttgggcattcttctgtttgtacaaat
gcaaatggatatagcatctacagaattacctcaagtttccagattggagaagaagagtgg
catgcagaacagcgagatggttctgaaatgtccnagtggatttctgagactcaggaaata
tctgtaatctcagatacaccttttcccatctatttcattgcttcaggcaagttccttgga
aatcaaatcttgagttatggtcaaaacctgacattctcttttcggatcgataggcgagac
acacgcctttctgctgaggatattattcttgaaggtgctggactgagagtatcagtccct
ctaatagctcaaggcaactcctatcccagtgagaacatagtgaagtacactttcaggctc
catgaagcaacagattatccctggaggccttctcttaccccatttgagttccagaagctg
ctccgcaatttaacagctatcaagattcgtgggacttacagtgagaggaatgctggatat
ttagatgatgtcactattgtgagtgctcggcctgggcctggaatcacagcaacgtgggtg
gaaagttgtacttgtcctacaggatatttggggcagttctgtgaacaatgtgctgatggc
tacaggagagagactcccagtctagggccttacagtccatgtgtgccatgtttctgcaat
gggcatagtgaaacctgcaaccctgaaactggagcctgtaactgcagagacaacacagca
ggtcctcattgcgagaagtgcagtgatggctattatggagatgcaactacaggaacttct
tcagattgccagccgtgtccatgtccaggagggtcaacttgtgccatcgtaccaaaaacg
aaggaggtggtgtgcactaattgcccagctggtactacaggcaaaaggtgtgaactgtgt
gacgatggctattttggagacccacttggcacaaacggtcctgccaggttttgccgcctc
tgccagtgcagtgacaacattgaccctaatgctgttgggaattgcaaccgcttgacaggg
gaatgtctgaaatgcatctacaatacagctggcttctattgtgaccggtgcaaagatgga
ttctacgggaatcccttagctcagaatccagaggacaaatgcaaagcttgcaactgtaat
ccttatggaaccatgaatgtgcagacaagctgcagtcaagtgaccggccaatgtgagtgc
ctcccccatgtgacagagcgggactgcagctcctgtgagcctggcttttacaacttgcag
agcggacgtggttgcgagaggtgtgactgccatccgttgggttccacaaatggccactgt
gacatacagactgggcagtgcgaatgccagccaggcatcactggccagcgttgtgagagg
tgtgaagccaaccattttggatttggtcgtgaaggctgcaaaccttgtgactgtgaccct
gaaggttctcgctctcttcagtgtaaagatgatggtcgttgtgaatgcaaagaaggattt
gtgggaaatcgttgtgaccaatgtgaagagaactatttttataaccgatcctggcctggc
tgtcaagagtgtcctgcctgttatagactggtgaaagataaggtggcagaacaaagggag
agattacaggaactggaaaaccttatagccaacataggaacaggtgatgaaactataaca
gaccaggcctttgaagacagactgaaagatgcagagagggatgtcatggacttgctccga
gatgctcaaagcatcaaagatgtagatcaaggtttgatggatcgcctgcatgagatcaac
agaaccctgtccagtcagcttggtaggttgaggaatattcaaaacacagtggatgaaaca
gaaaaccttgcagggcaggcccaaacccgggttgacaacacacaagaactcattgaaaca
gcttccaatatgctacagagagcaaggatggctgttgccaatgtgtctattactccacca
caatcaactggagaccccaacaatatgacagtcctggcggaagaagcccgccagctagct
acacgacacaaagaagaagcggatgacattgtccgtatagctaaggaagcaaatgataca
tcctcacaagcataccagttgctcttggacacactgtcaggagagaaccagacaatggat
gacatcaatgaccttaacagaaagtataaccaagcaaagaacatctcccgagatttggaa
aggcaggcaaacaaggtccatgcggaagcagaggaagctgggaacaaagcgctgcagatc
tatgctaatctcaccagtctgccatctatagacactgacaaactagagaatgaggcaaat
aaaatcaagaaagaagccagagatctggaccagctaatcaccagaaagctgaaagattat
gaagatctgagagaagacatgaaagggaaggagctggaggtacaaaaccttttggagaaa
ggcaaaactgaacagcagactgctgatcagctcttggctcgagcagatgctgcaaaggct
ctggctgaagaagctgccaagaaggggaaggacacgctccaggaggccaatgacattctc
aacaatttgaatgattttgataagcgtgtgaacgataacaagactgctgctgaggatgct
ctaaagaaaattcctgccattacccgtactattttggaggccaacaataagacccgtcaa
gcggaagcagcattggggagcgctgctgctgatgccagggaagcaaagaacaaagctggt
gatgctgagaaaattgctagttctgttcagaaaaatgctgctgagaccaaggctgatgct
gacaagaccttctctattgttgccgatttggacaaagaagtggatgacatgctgcagcaa
ctggaagatgctgaaaaagaactaaagaggaaacaggaaagtgcggatcaagatatgatg
atggcaggaatggcttcacaagcagctcaggaagcagaagacaatgcaaggaaagcaaag
aactctgttaacagcttactcagcacaatcaatgacctcctcgagaagttagggagtgtg
gagcctgtggattcaagtaaactgaatgatattgaagataccttaaatgctgccaaaaaa
cagatgagggacaacgatctggatcaaaaagtgtctgatctagagaaagcagcagaaaag
caagccagtgccatcagtgaatacaacagggacattagcaccatcaggaaagacattgcc
aatctagaggacatcaagaagaccttaccaactggctgtttcaacaccccgtccattgaa
aaaccctaa

DBGET integrated database retrieval system