KEGG   Anolis carolinensis (green anole): 100558169Help
Entry
100558169         CDS       T01608                                 

Gene name
cacng7
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04260  Cardiac muscle contraction
acs04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100558169 (cacng7)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100558169 (cacng7)
   04261 Adrenergic signaling in cardiomyocytes
    100558169 (cacng7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acs04040]
    100558169 (cacng7)
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100558169 (cacng7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 Amastin Serinc L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 100558169
NCBI-ProteinID: XP_003225896
Ensembl: ENSACAG00000016542
UniProt: H9GNB9
Position
Un
AA seq 281 aa AA seqDB search
MSNCSSRALTLLSSVFGACGLLLVGIAVSTDYWLFMEEGIVFPQNQTTEIVMALHAGLWR
VCFFAGQKKGSCVASEYFLEPRPDPDPEGPLVTENTENILKTIRTATPFPMVSLFLVFTA
FVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSGSEQYFQYR
YGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLHP
EVWHRGRSPSDISSDVSIQMTQNYPPAIKYPEHMHISTSPC
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactgcagcagccgcgccctgaccctgctgtctagtgttttcggagcgtgtggg
ctgctcctggtgggcatcgctgtcagtacggactactggctgttcatggaggaagggatt
gtgttcccacagaaccagaccacggagatagtcatggcgctccatgctggcctttggagg
gtctgcttctttgctggtcagaaaaaaggcagctgtgttgcttctgaatacttcctagaa
ccgaggcctgaccctgatcccgaaggccctctcgttacggagaacaccgaaaacatcctc
aaaaccatccgcacagcaacccctttccccatggtcagcctctttctcgtcttcacagca
tttgtcattagcaacattggacatatccgcccccagaggaccatcctagccttcgtttct
ggaatcttcttcatcctctctgggctctctctggtggtgggcctggtcttgtacatctcc
agcatcaatgatgaagtgatgaaccgtcccagtggctccgagcagtatttccagtaccgc
tacggatggtccttcgcttttgctgcttcttccttcttgctcaaagagggcgcaggcgtg
atgtctgtctacctcttcaccaagcgctacgctgaggaagaaatgtaccgtccgcacccg
gccttctaccgcccgcggctgagcgactgttctgactactcaggccagttcttgcacccc
gaagtgtggcaccgcggacgcagcccctctgacatctccagcgacgtttccatccagatg
actcagaactacccaccagcgatcaagtaccccgaacatatgcacatatccacctcacct
tgctag

DBGET integrated database retrieval system