KEGG   Anolis carolinensis (green anole): 100558242Help
Entry
100558242         CDS       T01608                                 

Gene name
hadhb
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
  KO
K07509  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00062  Fatty acid elongation
acs00071  Fatty acid degradation
acs00280  Valine, leucine and isoleucine degradation
acs01100  Metabolic pathways
acs01212  Fatty acid metabolism
Module
acs_M00085  Fatty acid elongation in mitochondria
acs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100558242 (hadhb)
   00071 Fatty acid degradation
    100558242 (hadhb)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100558242 (hadhb)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     100558242 (hadhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 100558242
NCBI-ProteinID: XP_003229841
Ensembl: ENSACAG00000008721
Position
Un
AA seq 473 aa AA seqDB search
MTSMLTCAAKTLPAVSPWAARLSVRLLSCSPHLHAAAQPKSKKTLAKNGVKNIVVVDGVR
IPFLQSGTSYADLMPHDLSRAALKGLLNRTDVPKEAVEYIVFGTVIQEVKTSNVAREAAL
GAGFSDKTPAHTVTMACISSNQAMTTGVGLIASGQMDVVVAGGVELMSDVPIRHSRKMRK
MMLGLPRAKSIGQRLSLLSRIRPDFFTPELPAVAEFSTSETMGHSADRLAAAFAISRTEQ
DQYAFRSHSLAKKAQDEGLLTDLIPFKVPGRDTVVKDNGVRPSSVEQMGKLKAAFVKPYG
TVTAANSSFLTDGASAVLLMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATPK
VLERAGLTMADIDVFEFHEAFAGQILANMKAMDSDWFAQNYMGRKSKVGAPPLEKFNTWG
GSLSLGHPFGATGCRLVMTTAHRLKKEGGQFGLVAACAAGGQGHAMLVELYPQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccatgttgacctgcgctgccaagacccttcctgctgtctctccgtgggctgcc
aggctctctgtgaggctcctcagctgttcaccccatctacatgcagcagctcagcccaag
agtaagaaaacattagccaaaaatggggtgaagaacattgtggtggtggatggtgtccgc
atcccgtttctgcagtctggaacttcatatgcagacttgatgccgcatgacctgtccaga
gcagcactgaaaggtttgctgaaccggaccgatgtgccgaaggaggctgtggagtatatt
gtctttggcaccgtgatccaggaggtgaagaccagcaatgtggccagagaggcggccctg
ggagccggcttctccgacaagacccctgcccacacggtcaccatggcctgcatctcctcc
aaccaggccatgaccacaggagtgggcctcattgcctccggccagatggacgtggtggtg
gccggcggggtggagctgatgtcggacgtccccatcaggcacagccggaagatgcggaag
atgatgctgggcctcccgcgcgccaagagcatcggccagcgcctctccctgctctccagg
atccgccccgacttcttcaccccggagcttcctgcggtggccgagttctccaccagcgag
accatgggccactccgctgaccgcctggccgcagcctttgccatctcgcgcacggagcag
gaccagtacgccttccggtcccacagcttggccaagaaggctcaggacgagggcctgctc
accgacctcatccccttcaaggtgccaggcagagacacggttgtgaaggataacggcgtc
cgcccgtcttcggtggagcagatggggaagctgaaggccgctttcgtcaagccttacggg
accgtcacggctgccaactcctctttcctgacagacggtgcctcagcggtcctcctgatg
tccgaagagaaggctttggccatgggctacaaaccaaaggcctacctcagggatttcgtc
tatgtttcccaggacccaaaggaccagctcctcctcggacccacttacgccacccccaaa
gtgctggagcgggccggcctcaccatggccgacatcgacgtcttcgagtttcatgaagcc
tttgcggggcaaatcttagcaaatatgaaggcgatggattcggattggtttgctcagaac
tatatgggccggaagtctaaggtcggggcccctccgctggagaagttcaacacctggggc
gggtccctctcgctgggacaccccttcggggccactgggtgccgcctggtcatgacgact
gcccaccggctgaagaaggagggaggacagttcggcctggtggccgcgtgcgctgctggg
gggcagggccacgcgatgcttgtggagctttacccgcagtaa

DBGET integrated database retrieval system