KEGG   Anolis carolinensis (green anole): 100558271
Entry
100558271         CDS       T01608                                 

Gene name
cars2
Definition
(RefSeq) cysteinyl-tRNA synthetase 2, mitochondrial (putative)
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100558271 (cars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acs01007]
    100558271 (cars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acs03016]
    100558271 (cars2)
Enzymes [BR:acs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     100558271 (cars2)
Amino acid related enzymes [BR:acs01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   100558271 (cars2)
Transfer RNA biogenesis [BR:acs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    100558271 (cars2)
 Prokaryotic type
    100558271 (cars2)
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DALR_2 tRNA-synt_1f Alfin
Other DBs
NCBI-GeneID: 100558271
NCBI-ProteinID: XP_008105205
Ensembl: ENSACAG00000006129
UniProt: G1KF26
Position
3
AA seq 575 aa
MARAWLLQQLLLSPARARLRAASPALQRMGLSSGGAKWLQPRGPESGIQTYNSLSKSKEP
LVLRNPDVVTWYSCGPTVYDHAHLGHACSYVRFDIIRRIMTRLFGKEVVMVMGITDIDDK
IIKRANEMGISPLTLARFYEEDFKQDMAALKVLPPTVYMRVTENIPQIISFIQKIIASRH
GYATSKGNVYFDVRSRGERYGKLANIYPDAQEEPVDSDKSHVKDFALWKAAKPQEMCWDS
PWGKGRPGWHIECSTISSLVFGGHLDIHTGGIDLAFPHHENEIAQCEVYHQCDQWANYFL
HSGHLHVKGSEKMSKSLKNYITIKDFLKEFSSDQFRMLCLRSRYRAGIEYSDDHMSEAKS
ILQIIYFFLSSVNAYMKGQLLCEDIREDVLWERLAHTKAAVRAACADDFDTPRAVGAIMD
LIHHGNRQLKAVTKETGSPRSAMVFGAIVSYIVEFLNTVGIALSEGEVTPENKHSAILSS
VIDELVSFRTKVRNFALAAPEATGGDMSAEHAVPSKEAKQRQKEERQRLLKERETLLQAC
DDLRQDLSLYGITIKDRSTTSTWELREPSKELENS
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggctcgcgcttggctgctgcagcagctgctgctatccccggcccgggcccgcctccga
gccgcctcgcctgccttgcagaggatgggcctctcctccggtggcgccaagtggctccag
ccccgcggcccagagagcggcatccagacctacaacagcctcagcaagagcaaggagccg
ctggtcttgcggaaccccgatgtggtcacttggtatagctgtggaccaactgtgtacgat
catgcacaccttgggcatgcttgctcctatgtcaggtttgatataattagaagaataatg
acacgtttatttggaaaggaagtggtcatggtgatgggaattacagatatcgatgacaaa
ataattaagagagccaatgagatgggtatatcaccattgactcttgcccgtttttatgag
gaagactttaagcaagatatggctgccttaaaggttcttcctcctacggtctatatgaga
gtgactgaaaatattcctcagattatttcttttatacagaagatcattgctagcagacat
ggctatgcaacctcaaaaggtaatgtttattttgatgtccgttctaggggagaaagatac
ggaaaattggcaaatatttatcctgatgctcaagaagaaccagtggatagtgataagtcc
catgtgaaggattttgctctttggaaggcagccaaacctcaagagatgtgctgggattca
ccctggggcaaagggcggcctggctggcacattgaatgttcaaccatatccagtttagtg
tttggaggacacttagatattcacactggtggaatagatcttgcgtttccccatcatgaa
aatgaaattgctcaatgtgaagtttatcatcagtgtgaccaatgggcaaattatttttta
cattctggacatctgcatgttaaagggagtgaaaaaatgtcaaaatcactcaaaaactac
attactattaaggatttcttgaaggagttttcatctgatcagtttagaatgctttgtttg
cggagcagatatagggcaggtatagaatacagtgatgaccacatgagcgaggcaaagagc
atccttcagataatctatttttttctgagtagtgtgaatgcctacatgaaaggacaactt
ctctgtgaagacattagagaagatgtactgtgggaaagacttgctcacactaaagccgcc
gtaagggctgcctgtgccgatgactttgacacccccagggctgttggtgcaattatggac
ctcattcaccatggcaacagacagcttaaggccgtcactaaggaaactggatctcctcga
agtgccatggtatttggagccattgtttcctatatagtggaatttcttaacactgttggg
attgcactttctgaaggagaggtcactcccgaaaacaaacattcagccattcttagcagc
gtgatagatgaattggtaagcttccgaaccaaagtacgcaattttgcacttgctgcacct
gaggcaactggaggagatatgtcagctgaacatgctgtcccatcgaaagaagcaaaacag
cgacagaaagaggaaagacagagactgttgaaggagagagagacccttctgcaagcatgt
gatgacttgcgtcaagacctatctctgtatggcatcactataaaggatagaagcacaact
tctacatgggaactcagagaaccaagtaaagagctggaaaacagctaa

DBGET integrated database retrieval system