KEGG   Anolis carolinensis (green anole): 100558667Help
Entry
100558667         CDS       T01608                                 

Gene name
pudp, hdhd1
Definition
(RefSeq) pseudouridine 5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100558667 (pudp)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     100558667 (pudp)
Protein phosphatases and associated proteins [BR:acs01009]
 HAD phosphatases
  Other HAD phosphatases
   100558667 (pudp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 100558667
NCBI-ProteinID: XP_003218876
Position
3
AA seq 295 aa AA seqDB search
MRGGRYKPKTKTKKKPPPPSKERHRSGSAQAHTTQGFPEAPKATPLLAGGRCCCAMAAES
ASSSSSASPRPLQPVTHLLFDMDGLLLDTERLYTVVYQEICKRYGKSYTWDVKSLAMGKK
ALEGAKIIRDALDLPLTKEELLHECQIKQEKLFPTAALMPGVEKLIRHLHQHNIPIAVAT
SSSRVTFEMKTSRHKDFFNLFHHIVLGDDPEVKDGKPQPDVFIVCAKRFNPPPLPEKCLV
FEDAPNGVKASLTAGMQVVMIPDENLDKELTKEATLVLHSMNEFKPELFGLPPFD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggaggaagatacaaaccaaaaacaaaaacaaaaaaaaaaccgccgccgccatcg
aaggagaggcacagaagcggcagtgcgcaggcgcacacgactcaaggcttccctgaggcg
ccaaaggctactcctctgcttgcgggaggtcgctgttgctgcgctatggctgcggagtcc
gcctcctcctcctcctctgcttccccgaggccgctgcaacccgtcactcacctcctcttc
gatatggacgggctcctgctggatactgaacgtctttacacagttgtgtaccaagaaatc
tgtaaacggtatggaaaatcctatacctgggatgtgaaatccttagcaatgggcaaaaaa
gcattagagggagcaaagatcattcgagatgccctggatcttccattaaccaaagaagag
ctactgcatgaatgtcaaattaaacaggagaaactgtttcccacagcagcactcatgcca
ggagttgaaaaactaatccgccatttacatcaacacaacatacccatagctgttgccacc
agctcatcccgagtgacatttgaaatgaaaactagtcgacacaaagacttcttcaattta
tttcatcatattgtgttgggagatgaccctgaagtgaaggatggcaagccacagcctgat
gtgtttatagtttgtgcgaaaagatttaatccaccaccacttccggaaaagtgccttgta
tttgaagatgctccaaatggggtgaaggcttcactgacagccgggatgcaggtggtcatg
attccagatgaaaacctggacaaagaacttacaaaagaagccacactagtgctccattct
atgaatgagttcaagccagaactgtttggtttaccaccttttgattga

DBGET integrated database retrieval system