KEGG   Anolis carolinensis (green anole): 100558723
Entry
100558723         CDS       T01608                                 

Gene name
asic1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acs04040]
    100558723 (asic1)
Ion channels [BR:acs04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100558723 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100558723
NCBI-ProteinID: XP_003216979
Ensembl: ENSACAG00000016987
Position
2
AA seq 527 aa
MMDLKVDEEEVENGQPVSIEAFASSSTLHGLSHIFSYERLSVKRVFWTLCFLGSLALLLF
VCNERIQHYFCYPHVTKLDEVATTHMTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQMADEKQLEILQEKANFRSFKPKPFNMREFSDRAGHDIQEMLLSCLFRGEPC
GPDDFKVVFTRYGKCYTFNSGQPDKPPLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLLYLPPPWGQCKSVTMESDF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVERDSEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKFRLCRRGKCQKKHNGNNSD
KGVTLSLDDVKRHNPCENIRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaggaggtggagaacgggcagccggtgagcatcgag
gcgtttgccagcagctccacactgcacggcctctcgcacatcttctcctacgagcgcctc
tccgtcaagcgcgtcttctggaccctctgcttcctgggctccctggccctgctgctcttt
gtctgcaacgagcgcatccagcactacttctgctacccccatgtcaccaagctggacgag
gtggccaccacccacatgaccttcccggccgtcaccttctgcaacctcaacgagttccgc
ttcagccgggtgaccaagaatgacctgtaccacgccggggagctcctggcccttctcaat
aacaggtacgagattccagacacccaaatggctgatgaaaagcagctggagatcctgcag
gagaaagcaaatttccgcagcttcaagcccaaacccttcaacatgcgggaattctcagac
cgagctggccacgacatccaggaaatgctgctctcctgcttgttccgtggggagccctgt
ggaccggatgacttcaaagtggtgttcacacgctatggaaagtgctacacgttcaactca
ggtcagcctgacaagccaccactcatcaccatgaaaggaggaactgggaacggcttggag
atcatgctggatattcagcaagatgagtatcttcctgtttggggagaaacagatgagacc
tcatttgaagctgggatcaaagtgcagatccacagccaggatgagccacccttcattgac
cagctgggatttggagtggcacctggtttccagacatttgtgtcctgccaggagcaacgg
ctcctctaccttcctcctccctggggtcaatgcaaatcagtgacaatggaatcagatttc
tatgatacctacagcatcacagcttgccgcatcgactgtgaaactcgatacttggtagag
aactgcaactgtcgcatggtgcacatgcctggtgatgctccctattgcacccctgaacag
tacaaggagtgtgcggatccagcccttgactttttggtggagagggacagtgaatactgc
gtgtgtgagatgccttgcaacgtcacccgctatggcaaggaactctccatggttaagatc
cccagcaaggcatcagccaaatatctggccaagaaatataacaagagcgaacaatacatt
ggggagaacatcctggtgctggacattttctttgaagctctgaactatgagaccattgag
cagaagaaagcatacgaagtggctggacttctgggtgacattgggggacagatggggctc
ttcattggagccagtatattaactgtgcttgagctatttgactatgcttatgaggtgata
aagttccgcctctgtcgccgtggcaagtgccagaagaaacacaatggaaacaacagtgac
aaaggtgtaaccctgagcctggatgacgtgaagcgccataatccatgcgagaacatcaga
ggccacccagcaggcatgacgtacgcagccaacatcctacctcaccacccggcccggggg
accttcgaggactttacctgctaa

DBGET integrated database retrieval system