KEGG   Anolis carolinensis (green anole): 100559138Help
Entry
100559138         CDS       T01608                                 

Gene name
prkacb
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04020  Calcium signaling pathway
acs04114  Oocyte meiosis
acs04140  Autophagy - animal
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04310  Wnt signaling pathway
acs04340  Hedgehog signaling pathway
acs04371  Apelin signaling pathway
acs04530  Tight junction
acs04540  Gap junction
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04916  Melanogenesis
Module
acs_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100559138 (prkacb)
   04310 Wnt signaling pathway
    100559138 (prkacb)
   04340 Hedgehog signaling pathway
    100559138 (prkacb)
   04371 Apelin signaling pathway
    100559138 (prkacb)
   04020 Calcium signaling pathway
    100559138 (prkacb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100559138 (prkacb)
  Cell growth and death
   04114 Oocyte meiosis
    100559138 (prkacb)
  Cellular community - eukaryotes
   04530 Tight junction
    100559138 (prkacb)
   04540 Gap junction
    100559138 (prkacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100559138 (prkacb)
   04912 GnRH signaling pathway
    100559138 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    100559138 (prkacb)
   04916 Melanogenesis
    100559138 (prkacb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100559138 (prkacb)
   04270 Vascular smooth muscle contraction
    100559138 (prkacb)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100559138 (prkacb)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: AGC group
  PKA family
   100559138 (prkacb)
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100559138 (prkacb)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100559138 (prkacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100559138
NCBI-ProteinID: XP_003223137
Ensembl: ENSACAG00000005844
UniProt: H9GAL8
Position
Un
AA seq 398 aa AA seqDB search
MAAQKELQGNPSTGTANALQRLEGFANRLFHRHSKGSSSELKAAQENESPHFSELAALWE
RSMKEFLAKAKEDFLRKWESPPQNTAGLEDFERLKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcagaaggagttacagggcaacccaagcacagggactgcaaatgctttgcag
agactggagggatttgccaacaggctttttcacaggcactccaagggctcctccagtgaa
ctgaaagcagctcaggaaaatgagtctccgcacttctctgaacttgctgcactgtgggag
agatcaatgaaagagttcctagccaaagccaaagaagattttttaagaaaatgggaaagc
ccccctcagaatactgctggtttagaagactttgagaggctaaaaacacttggaactggg
tcatttggcagagttatgttggtgaagcataaagcaacagaacagtattatgccatgaag
atactggataaacaaaaagtggttaaactgaagcaaatagaacacacactgaatgaaaaa
agaatattacaagcagtgaactttccttttcttgtaagactggagtattcttttaaggac
aattctaatttatacatggttatggaatatgttcctgggggtgaaatgttctcacattta
agaagaattgggaggttcagtgaaccacatgcaagattttatgcagcccagatagtgcta
acttttgagtacctccactcactagacctcatttacagagatctaaaacccgaaaacctt
ttaattgaccaacaaggatatatccaggtcacagacttcgggtttgcaaaaagagtaaaa
gggaggacctggacgttatgtgggactccagaatatttggctcctgaaataattctcagc
aagggctacaacaaagcagtagattggtgggccttaggagtgctaatttatgaaatggca
gctggatatccaccattctttgcagatcagccaatccagatatatgaaaaaattgtttct
ggaaaggtacggttcccatcgcacttcagttcagatcttaaagatctactaagaaattta
ctccaagtagatttgaccaaacgatatggcaatctcaagaacggagtgaatgatattaaa
aatcacaaatggtttgccactacagattggattgccatttatcagagaaaggtagaagcc
cccttcataccaaaatgtagaggtcctggagataccagcaattttgatgactatgaggaa
gaagatatccgcgtgtctctaacagaaaaatgtgcaaaggaatttgctgatttttag

DBGET integrated database retrieval system