KEGG   Anolis carolinensis (green anole): 100559451Help
Entry
100559451         CDS       T01608                                 

Gene name
uros
Definition
(RefSeq) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00860  Porphyrin and chlorophyll metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100559451 (uros)
Enzymes [BR:acs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100559451 (uros)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 100559451
NCBI-ProteinID: XP_003218642
Ensembl: ENSACAG00000000920
UniProt: G1K8Y2
Position
3
AA seq 265 aa AA seqDB search
MKVLLLKDPKESENGPDPYIEELGSHGLEATLIPVLAFEFISLQSLFEKLSCPEQYLGLI
FTSPRAVEAIKLCLADKSKKEDWKNYLREKWNTKSIYVVGKATAVLVAELGLIPQGENSG
NAEKLSGYICSRESPNSLPLLFPCGSLKRETLPTILREKGIALEILTVYQTTQHPDLQES
LRNYFSQQGVPASITFFSPSGVKYCLKQIMKLSGDLITQIKFAAIGPTTAEALETEGISV
SCTATSPTPQDLTTGIRRSLQLKDC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcctgttgctgaaggatcccaaagaaagtgaaaatgggccagatccatatata
gaagagctgggttcacatgggcttgaagcaacattgattccagttttagcgtttgaattt
atttcacttcagtccttgtttgaaaaactttcttgtcctgaacaatatctcggattaatt
tttacgagtccgagagctgtggaagctattaaattatgtctggctgataaatctaaaaag
gaagattggaaaaattatctgagggaaaaatggaacaccaaatcaatttatgtagtcgga
aaagctacagctgtactagtagctgaattaggacttataccacaaggagaaaactctggg
aatgctgaaaaactctctggatacatttgttcccgggaatcacccaactctttgcctctg
ctatttccatgtggcagtctgaaaagggaaacacttccaacaatactcagagaaaaaggt
attgcactggaaattctcactgtttatcaaactactcaacatcctgatcttcaagaatcc
ttgagaaattatttctcacaacagggtgttcctgcgagcatcacattttttagtccttct
ggtgtcaagtattgtctgaagcagattatgaaattatctggtgatctcattacccaaatt
aagtttgctgccataggtccaacaacagctgaagctctggaaactgaaggaatctcggtg
agctgtactgccactagccctactccacaggatctcaccacagggattagaagaagtctt
cagctcaaggattgctag

DBGET integrated database retrieval system