KEGG   Anolis carolinensis (green anole): 100559844
Entry
100559844         CDS       T01608                                 

Gene name
ilkap
Definition
(RefSeq) ILK associated serine/threonine phosphatase
  KO
K17500  integrin-linked kinase-associated serine/threonine phosphatase 2C [EC:3.1.3.16]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    100559844 (ilkap)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100559844 (ilkap)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100559844 (ilkap)
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 100559844
NCBI-ProteinID: XP_008104645
Ensembl: ENSACAG00000006573
UniProt: G1KFI7
Position
3
AA seq 392 aa
MDLFGDFPEQASAAPAAIDKEERRGSLLFDDLPPVSGTDLDAGSSLLFDDLPPASSGNTV
SHPAEQVSLPVSYGRGEKRKSTEGEKNGSEELVEKKVCKDFSEILPLKGYVAERKGEREE
MQDAHVILNDITEECSPLPSQITRVSYFAVFDGHGGVRASNYAAQNLHQNLIRKFPKGDV
PSVEKAIRRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLVIDNTLYIANLGDSRAI
LCRYNEENQKHTALSLSKEHNPTQYDERMRIQKAGGNVREGRVLGVLEVSRSIGDGQYKR
FGVISVPDVKRCQLTHNDRFILLACDGLFKVFSPEEAVNFIMSCLEDKTIPTRDAKSAAD
ARYEAACNRLANKAVQRGSADNVTVVVVRIEQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggatctgttcggggacttcccggagcaggcctctgcggcgcccgcagcaatcgataaa
gaagagcggagagggtctttgctttttgatgatctcccaccagtcagcggcactgacttg
gatgcaggaagctctttgctttttgatgatctcccacctgccagcagtgggaacacagtt
tcgcatcctgcagaacaagtttcccttcctgtgagctatggaaggggagaaaagagaaag
tccacggaaggggagaagaatgggagtgaagaacttgtggaaaagaaagtttgtaaagat
ttctctgagattcttcctctgaagggctatgtggcagagaggaaaggtgaacgagaagag
atgcaggatgcccatgtgattctgaatgatattacggaagagtgcagccctctgccctca
caaatcacccgcgtctcatactttgctgtctttgatgggcatggaggagttcgagcttca
aattatgcagcacaaaatctacatcaaaacttgataagaaagtttcccaaaggagacgtg
cccagtgtggaaaaggcaataagaaggtgccttctggataccttcaaacacactgatgaa
gaatttctcaagcaggcttccagccagaaacctgcctggaaggatggttctacagcaact
tgtgtactggtgatagataataccttgtatattgccaatcttggagatagcagggccatt
ctgtgtcgttacaatgaagagaatcagaagcatacagccttaagcctcagtaaggagcat
aacccaactcagtatgatgagcggatgaggatccaaaaggctggggggaatgtcagggaa
ggtcgtgttctcggtgttctagaagtctctcgatctattggagatggacagtacaagcgc
tttggggtcatttctgtgccagatgtgaaacgctgccaacttacacacaatgacagattt
atcctgttggcatgtgatggtcttttcaaagtcttctcaccagaagaagctgtgaacttc
atcatgtcttgtttggaggacaaaacgattcctacaagagatgccaaatcagccgccgat
gccaggtatgaagctgcctgtaacagattggccaacaaagctgtgcagcgagggtctgct
gataacgttactgtggtggtggtccggattgagcagtga

DBGET integrated database retrieval system