KEGG   Anolis carolinensis (green anole): 100559925Help
Entry
100559925         CDS       T01608                                 

Gene name
cpt2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00071  Fatty acid degradation
acs01212  Fatty acid metabolism
acs03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100559925 (cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100559925 (cpt2)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100559925 (cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf VBS
Motif
Other DBs
NCBI-GeneID: 100559925
NCBI-ProteinID: XP_003220341
Ensembl: ENSACAG00000008712
UniProt: G1KI37
Position
4
AA seq 664 aa AA seqDB search
MALLGLSSSPFRGAPAARLPPLLSGPRRRHYGQETSFPQHLHRSLVPTLHYQKSLPRLPI
PKLEDTIRRYLNAQRPLLDDDQFRKTEELAAKFEKGIGRELHEQLISQDKQNKHTSYISG
PWFDMYLRARESVVLNFNPFMVFNADSKVDYNNQLTRATNMTVSALRFLKTLRTNILEPE
VFHLNPAKSDTQAFKKFVRFVPPSLSWFCAYMVNAYPLDMSQYFRLFNSARLPKSNKDEL
FTDENERHLLVIRNGNFYVFDVIDRDGNILKPSEIQAHLQFILSDSSSVPAFPLACLTTE
NRDIWARLRQELLENGNAEALRKVDSAIFCLCLDDFPINGLNHLSHTMLHGDGINRWYDK
SFNLILAKDGTAAIHFEHSWGDGVAVLRFQNEVFKDSTQTPAITPQSQPAAVDSASSVQK
LNFKLNDALKEGITQAKQKFDATVKTLTLEAHQFERGGKEMLKKHKVSPDAIAQLAFQMA
FLQQYGQTVATYESCSTAAFKHGRTETIRPASIHTKACSEAIVRKSSKHSVAELQQMIAE
CSKYHNQLTKEAAMGQGFDRHLYGLRCVAESRGTPLPEFYQDQAYSQINHNILSTSTLSS
PAVSMGGFGPVVPDGFGVGYGIHNDWIGCNVSGYPARNVQEFVQCVHKSLDDIFNVLQGK
QVSN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctgggcctgtcctcctcgcccttccgcggagcccccgccgcccgcctcccg
cctctcctctcggggccccggcggaggcactacggccaggagacatcctttccccagcac
ttgcaccgcagcctcgtccccaccttgcattaccaaaagagcctgccccgtttgccaatt
ccaaaacttgaagatacaattagaagatacttgaatgcacaaagacctcttctagatgat
gaccaattcaggaaaactgaagaacttgctgccaaatttgagaaaggaattggccgagaa
ttacatgagcagttgatttcacaggacaagcaaaacaaacatactagttatatttcaggt
ccctggtttgacatgtacctaagggcacgtgaatcagttgttttgaacttcaatcctttc
atggttttcaatgctgactccaaagtggattataacaatcagctcacaagggcaactaac
atgactgtttctgctttgcgattcttgaagactctcaggactaacattttagaaccagag
gtttttcacctgaacccagccaaaagtgacactcaagcttttaaaaagttcgttcgtttt
gtgcctccttctctgtcatggttttgtgcctacatggtgaatgcctacccactagacatg
tcacagtacttcaggcttttcaattctgctcgactgcccaagtctaacaaggatgaacta
tttacagatgaaaatgagaggcacttattggtgattagaaatggaaacttttatgtattt
gatgtgatagatagagatgggaatatactgaagccttcagaaattcaagcacatctacaa
ttcatcctttctgacagtagctcagttccagcattccctcttgcgtgtctgactactgaa
aatcgggacatatgggcaaggttgagacaggagctactggaaaatgggaatgcagaagcc
ttaagaaaagtagattcagcaatattttgtctgtgccttgatgattttccaattaacggc
ttgaaccacttgtcccataccatgttgcatggtgatggcatcaataggtggtatgacaag
tcattcaacctcattttagccaaagacggcactgcagcaattcactttgaacactcttgg
ggagatggtgttgctgttcttagattccaaaatgaagtgtttaaagatagcactcagaca
cctgcaattacccctcagtctcagcctgctgctgttgattctgcctcatctgtacagaaa
ctgaactttaaattgaatgatgccttaaaagaaggaattacccaagccaaacaaaaattt
gatgctactgtgaaaacattgactctggaggctcatcagtttgaaagaggaggcaaggag
atgttaaagaagcataaagtcagtcctgatgctattgctcagctcgccttccagatggct
tttctgcagcaatatgggcaaactgttgccacctatgaatcgtgcagcactgcagctttc
aaacacggtcgcactgaaaccattcgtcctgcctccattcacacaaaggcatgttcagag
gccattgtcagaaagtcatccaagcacagcgtagcagagcttcaacagatgattgcagag
tgctctaagtatcacaaccagctcacaaaagaagctgctatgggccagggctttgatcgg
cacttgtatggcttgcgatgtgtggcggaatctcgaggaacccccttaccagaattttat
caggaccaagcctattcacagattaatcacaacattctctccacaagtactctgagcagc
cctgcggtctccatgggtggatttgggccagtggtccctgatggttttggtgtaggatac
ggaatacacaatgattggattgggtgtaatgtttctggctatccagcgaggaatgtgcaa
gaatttgtccagtgtgttcacaagtcactggacgatatttttaatgttctgcaaggtaaa
caggttagtaactga

DBGET integrated database retrieval system