KEGG   Anolis carolinensis (green anole): 100560114Help
Entry
100560114         CDS       T01608                                 

Gene name
gch1
Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00790  Folate biosynthesis
acs01100  Metabolic pathways
Module
acs_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100560114 (gch1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100560114 (gch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 100560114
NCBI-ProteinID: XP_003217566
Position
2
AA seq 251 aa AA seqDB search
METLNGDYFNGGFLLPVAGGEAAEKRGREKQQQPPPPPLRPHLPADRGPSSRERQGETEA
EEREQQARLSALEAAYGSILRGLGENPERQGLQRTPRRAAKAMQFLTKGYHENVAEILND
AMFDEDHDEMVIVKDIEMFSLCEHHLVPFFGKVHIGYLPMKKVVGLSKLARIVEIFSRRL
QVQERLTKQIAWAITEALKPVGVAVVIEASHMCMIMRGVQKMKSKTVTSTMLGVLREDPK
TREEFLSLIKS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagaccctcaacggggactacttcaacgggggcttcttgctgcccgttgccggcggg
gaggcggcggagaagagaggccgggagaagcagcagcagccgccgccgcctcctctccgc
cctcacctgcccgcagacaggggcccttcctcccgggagcgccagggcgagacggaggcg
gaggagcgggagcagcaggcgcggctgtccgccttggaggccgcctacggcagcatcctc
cgcgggctgggagagaaccccgagcggcaagggctgcagcggaccccccgccgggcggcc
aaagccatgcagttcctcaccaaaggctaccacgagaacgtcgcagaaatactcaacgat
gcaatgtttgatgaggaccacgatgagatggtgattgtgaaggatattgaaatgttttcc
ctctgtgagcatcacttggtccctttctttggcaaggtccacattggatacttaccaatg
aagaaagtggttggtttaagcaagcttgcaagaattgttgaaatatttagccgaagactt
caagtccaggagcgactcaccaaacagattgcctgggccatcactgaagctctgaaacct
gttggagtagctgtggtcatagaagcttcgcacatgtgtatgatcatgcggggcgttcag
aaaatgaagagcaaaactgtgacaagcaccatgctgggagtcttgcgagaagatccaaaa
accagggaggagtttctctccttgatcaagagttaa

DBGET integrated database retrieval system