KEGG   Anolis carolinensis (green anole): 100560465Help
Entry
100560465         CDS       T01608                                 

Gene name
cpt1c
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00071  Fatty acid degradation
acs01212  Fatty acid metabolism
acs03320  PPAR signaling pathway
acs04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100560465 (cpt1c)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100560465 (cpt1c)
   03320 PPAR signaling pathway
    100560465 (cpt1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acs03029]
    100560465 (cpt1c)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100560465 (cpt1c)
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100560465 (cpt1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 100560465
NCBI-ProteinID: XP_008111819
Ensembl: ENSACAG00000013620
UniProt: G1KP61
Position
6
AA seq 776 aa AA seqDB search
MAEAHQAVAFQFTVSPEGIDLQLSHVAFKEIYLSGVRSWKKKCNQLRNGFVTGVYPASPS
SWLFMVTAILVTQYSRLDPSMGMIDKIKEHLPVSGYLSDQGMNILSAATFSTVLWLALIM
TMRSILKMLLCYHGWMYEEHGKMSNTTKIWLALVKMFAGRKPMLYSYQASLPRLPVPALK
DTMQKYLESIRPLTTDAEFQRMAALARDFEQTLGPRLQWYLKLKSWWASNYVSDWWEEYV
YLRGRGPLMVNSNYYAMDFIYVTPTPVQAARAGNLVYAMMMYRRKLVQEEIKPMLIQGCL
PMCSAQWERMFNTTRIPGMEGDSIQHLQDSRHIAVYHAGRFFRVLLYHNGRMLRPRELQA
QFQSILGDPTPPSPGEEKLPALTAGERDPWARARNAFFQTGQNEQSLSIVEKAAFFVTLD
TSEQGLREPNPGQSLDAYAKSLLHGRCCDRWFDKSFTLIVYRNGKSGLNAEHSWADAPIV
GHLWEYCLATDAFTLGYDAYGNCKGDMDPNVPPPQKLQWEIPPECEAVIMQSFRVAYNLA
SDIDFHAFTFKDFGKGLIKKCRTSPDGFIQLALQLAHFRDKKKFCLTYEASMTRLFREGR
TETVRSCTIESCNFVKAMMDPTQDDSARLHLFRVAAEKHQNLYRQAMTGAGIDRHLFCLY
VVSKYLGLDSPFLREVLSEPWRLSTSQTPIQQLELFDLQNHPDYVSCGGGFGPVDDNGYG
VSYIIVGEDLINFHVSCKVSSPETDAHRFGLNIRNAMTDIALLFKANKKFAARGDQ
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaccaggctgtggctttccagttcactgtctctccggaggggatcgac
cttcaactcagccatgtggctttcaaggagatctatctctcgggcgtaagatcctggaag
aagaaatgtaaccagctacgaaatggtttcgtgacaggagtctaccctgccagcccttcc
agttggctcttcatggttactgccatcctggtgacccaatactctcgccttgacccctcc
atgggcatgattgacaagatcaaggaacacctaccagtcagtggttatctgtcagatcag
ggcatgaatatcctcagcgctgcaaccttttccacagtcctttggctggccctcattatg
acaatgcgtagcatattgaagatgctgctgtgctatcatggctggatgtatgaggagcat
gggaagatgtccaacaccacaaaaatttggctggcactggtgaagatgtttgctgggcga
aaaccgatgttgtatagctaccaggcttcactgccccgcttgcctgtccccgccctcaag
gatactatgcagaagtatttggagtccatacggccacttacgacagatgccgaattccag
cggatggcagctcttgcccgtgactttgaacaaacccttggacctcgcttgcagtggtac
ctcaagctcaagtcttggtgggcatccaactatgtaagtgactggtgggaagaatatgtc
tatctccgcggaagaggtcccctgatggtaaatagcaactattatgccatggattttatt
tatgtaacccccactccagtccaagctgctcgtgctggcaatctcgtttatgctatgatg
atgtacagaaggaagcttgtccaggaggagatcaagccgatgttgatccaaggttgtctg
cctatgtgctcagctcagtgggaacgcatgtttaataccacccgtataccaggcatggag
ggagatagcatacagcatctgcaggacagcaggcacattgctgtataccatgctgggcgc
ttctttcgggtcttgctgtaccacaatgggaggatgcttcgcccacgggagcttcaggca
cagttccagtccatcctaggagatcccacacctccttctcctggggaggagaaattgcct
gccctgactgcgggtgaaagagacccctgggctcgggcccgcaatgccttcttccaaaca
ggacagaacgagcagtcgctgagcatagttgagaaagctgccttctttgtcactctggac
accagtgagcaggggctgagggagcccaatccaggccaatctttggatgcctatgccaag
tccctcttgcatggacgctgctgtgacagatggtttgacaaatctttcacattgattgtt
taccgtaatgggaagtctgggctcaatgctgagcactcgtgggctgatgcacccatcgtg
gggcacctttgggagtactgccttgccactgatgcttttacgctggggtatgatgcttat
gggaactgtaaaggcgacatggatcccaacgtccccccaccccaaaagctgcagtgggag
atcccaccagagtgcgaggcagtgatcatgcagtccttcagggtggcttataacctcgcc
agtgacatagacttccatgcctttactttcaaggacttcggcaaaggtctcatcaaaaaa
tgccgcaccagtccagacggcttcatccagcttgccctccagctggcacattttcgggac
aagaagaagttctgcctcacatatgaggcatccatgacccgtctctttcgggagggccgc
acagaaacagtccgttcctgcaccattgagtcctgcaactttgtcaaagccatgatggac
cctacccaagatgatagtgccaggttacatctgttccgtgtggcagctgagaaacaccag
aacctttaccggcaagccatgacgggtgctggcattgacaggcacctcttctgcctctac
gttgtctccaaatatcttggcttagattccccctttttgcgtgaggtgctgtctgagcca
tggcgtctatccactagccagactcccatccagcagctggaactgtttgaccttcagaac
catccagactacgtttcttgtggtggtggatttgggccggttgatgataatggttatggc
gtttcatacatcattgtcggtgaagatctcatcaacttccatgtgtcatgcaaagtctcc
agcccagagacagatgcacaccggtttggactgaacatccggaatgcgatgacagacatt
gcactcttgttcaaagcgaacaaaaaatttgctgccagaggtgaccagtga

DBGET integrated database retrieval system