KEGG   Anolis carolinensis (green anole): 100560507Help
Entry
100560507         CDS       T01608                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:acs01002]
    100560507
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100560507
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S33
   100560507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF2048 Thioesterase
Motif
Other DBs
NCBI-GeneID: 100560507
NCBI-ProteinID: XP_016847180
Ensembl: ENSACAG00000011937
UniProt: G1KLQ2
Position
2
AA seq 338 aa AA seqDB search
MDLILLKIFLINLVTCFTLLLISLLTIYFLWPSKLMEMTNWFLSQKYGLKKNYVKHEGYQ
FCYYSQGKPGFEPSILLLHGFSLNKDMWLMSMPYFPKGTHSIFVDLPGHGETSCLPGDRY
KAVDQAKRLHQFVECTGLCRTPFHLVGISMGGMIAGVYAALYPSDLCALSLLCPAGVKYP
EDNVFMKHLKELNKNHKLDCDNPLVPLDVKGVRHLFKTGMFRSMFIPYQILKGLVKLREY
DNQFYSKCFIDLAQDDNLYCLHDHINKITTPMQVIWGKDDIILDPSGAEILARAIPGTQV
HLLDNCGHFILSDLPKIPIDLIMDFHTSVWFTMDKKLV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattttactcaaaatatttctcatcaacctggtcacatgcttcactttatta
ttgattagtcttctcactatatatttcctgtggccttcaaagctgatggagatgacaaat
tggttcttatctcagaaatatgggttaaagaagaactatgtcaagcatgagggttaccag
ttctgttactactcccaaggaaaacccggtttcgagccctccatcctgttgctgcacggc
ttctcgctcaacaaggacatgtggctaatgagcatgccatattttcctaagggcacccac
tcgatctttgtggacttgcccggacatggggaaacgtcttgtttgccaggagaccgttac
aaggcagtggatcaagccaaaaggttacaccagtttgttgagtgtacgggtttgtgcaga
acgcctttccacctagttggcatctccatgggcggaatgattgctggggtttatgctgct
ctctatccatcagacctctgtgcattgtccctcctttgcccagcaggtgtgaagtatcca
gaagataatgtgttcatgaagcacttgaaggagttgaataaaaaccacaaacttgattgc
gataatcctttggtacctttggatgtaaagggagtaagacaccttttcaaaactggcatg
ttcaggtctatgttcataccctatcagattttgaaaggactagtcaaactgcgagaatac
gacaaccaattttactcaaaatgttttatagacttggcccaagatgacaacttgtactgc
cttcatgaccacataaacaagatcacaactccaatgcaggttatctggggaaaggatgac
attatattggatccgtctggggcagaaattttagccagagctattcctggtacgcaagtg
cacttattggataactgtggacatttcatattatctgatttgcccaaaatacccatagac
cttatcatggacttccacacttcagtttggttcacaatggataagaaattggtataa

DBGET integrated database retrieval system