KEGG   Anolis carolinensis (green anole): 100561257
Entry
100561257         CDS       T01608                                 

Gene name
rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100561257 (rdh5)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100561257 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Augurin NAD_binding_10
Other DBs
NCBI-GeneID: 100561257
NCBI-ProteinID: XP_008112602
Ensembl: ENSACAG00000009989
UniProt: H9GFW1
Position
Un
AA seq 319 aa
MWCCVLLFSVLWTVVWFFRDRQMLSSFKDKYVFVTGCDTGFGNLLAKRLDKKGFQVLAGC
LTQKGADNLQRSSSPNLRTTLLDVTNSESIRKAVEWVKGEVGEKGLFGLVNNAGVANPIG
PTEWMIVEDYRKVMSINTFGMIEVSLAFLPLLKQARGRVVNTSSVLGRLSANGGGYCISK
YCVEAFSDSLRRDMYHFGVKVSIVEPGFFKTAVTNLDSIESSLRQIWDRMRPEARQSYGE
DFFSNYLKVQKFIMNLICDPDLSKVTNCMEHALEAKHPRTRYSAGWDAKFMWLPISYLPA
FMVDIVLATILPKPAQRVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgttgcgtgctgcttttcagtgtcctctggacagtggtctggttcttccgagac
cggcagatgttgagctccttcaaggataagtatgttttcgtcacaggctgtgacacaggc
tttgggaacctgttggccaagcggcttgacaagaagggcttccaagtgttagcaggctgc
ttgactcagaaaggggctgataacctgcagcgttctagctcaccaaacctgcggaccacc
ctcctcgatgtcaccaactctgagagcatccgcaaagccgttgagtgggtgaaaggtgaa
gtgggtgaaaaagggttatttggcctagttaacaatgcaggtgtggccaaccctattggc
cctacagaatggatgatagtggaggattaccgtaaggtcatgtctatcaacacttttggc
atgatcgaggtctcattggctttcttgcccctgctcaagcaagctcgtggccgtgtggtc
aatacctccagcgtcttgggtcgcctctcagctaacggtggtggctactgtatttccaaa
tactgtgttgaggccttctccgacagcctcaggagggatatgtaccattttggcgtaaaa
gtctccattgtggagccaggttttttcaagactgctgtgaccaatctcgattcaattgag
tcctctttgcgtcaaatctgggatcgaatgcgtcctgaggcccggcaaagctatggtgaa
gacttcttttcaaactacctgaaggtccagaagttcatcatgaacctcatttgtgaccca
gacctcagcaaagtgaccaactgcatggagcatgccctagaggctaagcaccctcgcacc
cgctacagtgctgggtgggatgccaagtttatgtggctgccaatctcttacctgcctgct
ttcatggtggacattgttctggctacgattctaccaaagccagcacagagggtccgctag

DBGET integrated database retrieval system