KEGG   Anolis carolinensis (green anole): 100561409Help
Entry
100561409         CDS       T01608                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00564  Glycerophospholipid metabolism
acs00565  Ether lipid metabolism
acs00590  Arachidonic acid metabolism
acs00591  Linoleic acid metabolism
acs00592  alpha-Linolenic acid metabolism
acs01100  Metabolic pathways
acs04010  MAPK signaling pathway
acs04217  Necroptosis
acs04270  Vascular smooth muscle contraction
acs04370  VEGF signaling pathway
acs04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100561409
   00565 Ether lipid metabolism
    100561409
   00590 Arachidonic acid metabolism
    100561409
   00591 Linoleic acid metabolism
    100561409
   00592 alpha-Linolenic acid metabolism
    100561409
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100561409
   04370 VEGF signaling pathway
    100561409
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100561409
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100561409
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100561409
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100561409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100561409
NCBI-ProteinID: XP_016847544
Position
1
AA seq 797 aa AA seqDB search
MQEETSPCYFLSVRVIRARNLRKGDILTPTDAYLMLWMPTASSAQFRTKTVQNCKDPVWN
ETFHFMVQSRAKNVLELGVYDEDVCFDDHLFTVCFDIAGLQLNEKVLMCFISNLKKHEQL
EIEFELSNRLSFLETIITNGVLLSRQLCQLECEVERKKKQKSEETLTLMVKGSHEENQEF
NVSSSFCLRPRHQSSFHYIKYKHQILEVKLLKKDLEYAFGPCSYNTEENILKVEINSIPT
SKKIVLAESKNYVLHVKAEDCQLGLDVRLGYDLCPQEQSFLCKRKRIVAGALKKVLKLEK
DLQDHEVPVVAIMTTGGSTRSLTALYGSLRGLQKLNLLDCATYMTGLSGTTWTMGNLYKD
AYWSKKDLSEQINEAKRHVTKSKRDNFSIERLKYYNRQLHQRKEEGQRTSCIDLWGLVIE
YLLNDGKDNHKLSDEQHAVNEGQNPLPIYTAINVKEKYSTMDFKEWMEFTPYEVGILKYG
AYVKAEDFGSEFFMGRLIKRLPETRLCYMQGMWSSIFSVNLLYFWSLVHSSEEFWHKWTH
DQITDIDEEPQLPSRLHEQKTQLCTPAGPFSCAFRDVLTNRLSIAQYHNFLKGLQLDNSY
LQNDNFCRWKGTVLDTRSPNQLTQTDKYLSLEDTGFFINTSSAPLMRKERKVDVILHLNY
SAGSQSLPLKQSCKYYAEQGIPFPKTVLNDDDKHLKECYLFEEEDSLDAPILLFFPQVND
TFRYYIAPGVKRSESEMKYGDIDVSSKYGPYSTYSMTYSKEEYDQLVDLSEYNILNNQYL
IRQALQRAVERKKLLKK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagaaacatcaccatgttatttcctgagtgtaagagtgattagagcaaggaat
ctcagaaaaggagatatcttgacccctacagatgcgtatctgatgttgtggatgccaaca
gcttcttctgctcagttccgaacaaagactgttcaaaattgcaaggacccagtctggaat
gaaacctttcatttcatggtccaaagcagagcaaagaatgtgctggagttgggtgtctat
gatgaagatgtctgctttgatgaccatctcttcactgtgtgctttgatatagctgggctt
caattaaatgaaaaagttcttatgtgctttatctctaatctaaagaaacatgagcagctg
gaaatcgagtttgagctgagcaataggttaagttttctggaaacaataattacaaatgga
gttcttttgtctcgccaactctgccaattggaatgtgaggtggagagaaaaaagaagcag
aagtcagaagaaacactaactcttatggtgaaaggatcccatgaagaaaatcaagaattt
aatgtttcctctagcttctgcctgaggcccagacaccaatcctcattccactatatcaag
tataaacatcaaatcttggaagttaaactactgaagaaggatctagaatatgcctttggt
ccgtgttcttataacacagaagaaaacattctaaaagtggaaatcaattcaattcctaca
agcaagaaaatagtactagcagagagtaaaaattatgttctacatgtgaaggcagaagac
tgtcaacttggcctcgatgtacgtttgggttatgatctgtgccctcaagagcaaagcttc
ttgtgtaaaaggaagagaattgttgctggtgctttgaaaaaagttcttaaactagaaaag
gacttgcaagatcatgaggttccagttgtggcaatcatgacaacaggtggcagcacacga
tcactgacagctttgtatggaagcctacgaggacttcagaaattaaatctcttagactgt
gcaacttacatgactggtttgtcaggaacaacgtggactatgggcaatttgtacaaagat
gcctattggtcaaaaaaggatctgtctgaacaaataaatgaggctaaaagacatgtgact
aaaagcaaaagggataacttttccatagagcgtctgaaatattacaacaggcagctgcat
caaaggaaagaagagggacaaaggacatcttgtatagatctttgggggctggtgattgaa
tatttgttgaacgatgggaaagataaccataaactctcagatgaacaacatgctgtgaat
gaaggtcaaaatcctttaccaatctacactgcgatcaatgtgaaagagaagtacagcact
atggatttcaaagaatggatggaattcacaccctatgaggtggggatcctaaaatatgga
gcttatgtgaaggctgaagattttggaagcgagttctttatgggacgtttaataaagaga
ctaccagagactcggctctgttatatgcaaggcatgtggagtagtatattttctgtaaat
ctactatacttctggagtctagttcacagttcagaggagttttggcacaagtggacacat
gaccaaataactgatattgatgaagagccgcaactaccttccagactgcatgagcaaaag
acacaactgtgtacacctgcgggacccttttcctgtgcttttagagatgtgcttactaat
cgcctctccattgcccagtaccataattttctgaagggtcttcaattggataatagctac
ttgcagaatgacaacttctgcagatggaaaggaactgtactagacactcgttcacccaat
caactgactcaaacagataaatacttgtctctagaagatacaggtttcttcatcaatact
agctctgcacctctgatgagaaaagagagaaaggtggatgtaattctccatttaaattac
agtgcaggatcacaatcattgcctttgaagcaatcatgcaaatactatgcagaacaagga
atcccattccccaaaactgtgctgaatgatgatgacaaacatctgaaagagtgctattta
tttgaagaggaagacagtctggatgcacctatattgctattttttccacaagtgaatgat
acttttcgctattatatagcacctggtgtgaagcgctccgagtcagaaatgaaatatggc
gatattgatgtttccagcaaatatggcccctattctacatattcaatgacttatagtaaa
gaagagtatgatcagctggtagacctgagtgaatacaatattttgaataatcaatatctg
attcgacaggccttgcaaagagcagtagaacggaaaaaattacttaagaaataa

DBGET integrated database retrieval system