KEGG   Anolis carolinensis (green anole): 100561568Help
Entry
100561568         CDS       T01608                                 

Gene name
parp12
Definition
(RefSeq) poly [ADP-ribose] polymerase 12
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100561568 (parp12)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100561568 (parp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE zf-CCCH_4 zf-CCCH zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 100561568
NCBI-ProteinID: XP_003220925
Ensembl: ENSACAG00000016815
UniProt: G1KT60
Position
5
AA seq 663 aa AA seqDB search
MLSTSSSRIYKELCASGGSLSEDELGRRLGLQGRAGLLAQLLQDASKFTLVTREEPPSSA
ASGGESRTVVAKTGARLCAQHGSGKCQGDCRQLHLCRFFVYGACRHQGTRKQCRFIHDFY
SPCNLAVLKEHELEKLSSDDLCQLLLQNDPSLLPEVCAYYNKGDGPYGSCNFKKICVKLH
ICQYYLHGDCRFGSNCKRSHDVFNPDCYEKLEKWGMTRALITRIPLIYRNAYDIRNSTPS
PCKERRESSSQVPSTTNSIDESDTICLYYIRKSCSFQDKCIRVHFHLPYRWQTLDGAQWK
DLANMEKIEQDYCDPFHERMVYNGLGNDSKVLVIDFSNMTCNSAKLRRLSTASSVTKAPY
YILTTDWIWYWKDECDVWNEYGVKDLDHDAATLSSFDLEKAYQSEASPTLKFSAGKHTYE
LDFRVMKQKNLRYLTERSIRRRPKFVSPKEVEEKKKTGGVAQSKGGTALIPAHWDQSALP
ELGYTLVTLLSSSNEYRKVQVNFQRTMPKATIVEIKRIQNRALWEVYQWQKEQMKKANDG
KDVDERQLFHGTNKSHVDAICQQNFDWRICGVHGTAYGKGSYFARDASYSDNYSDSTNKI
MFLARVLVGEFTIGMSSYLRPPQKEVQSTGFYNSCVNDLRNPSIFVIFEKHQIYPEYVIK
YRN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcacctcgtccagccgcatctacaaggaactctgcgcctcgggcggctcttta
agcgaggacgagctgggccgtcgccttggcctccagggcagagccggcctcctggcccag
ctcctccaggacgcctctaagttcacgctggtgacccgggaggagcctccttcctcggcg
gcgtcgggcggggagtcccggacggtcgtggccaagaccggcgcccggctctgcgcgcag
cacggcagcggaaagtgccagggcgactgccggcagctccacctttgccgcttcttcgtc
tacggagcctgccgccaccaaggcaccaggaaacagtgcagattcatccatgatttttat
tcaccctgtaacctcgcagtcctaaaagagcatgagctggaaaagttaagctctgatgat
ttatgtcagctgctgcttcagaatgatccttccctgttgcctgaggtatgtgcatattat
aataaaggggatggtccctatggatcttgtaactttaagaagatctgtgtcaaactccat
atatgtcagtactacctccacggagactgcaggttcggaagcaactgcaagcggtcacac
gatgttttcaatccagactgttatgagaagctggaaaagtggggaatgacccgagctcta
attactagaattcctctgatctacagaaatgcatatgacatcagaaatagcacaccatca
ccttgcaaagaaagaagagagagcagttcacaggttccatcaaccacaaatagcattgat
gaatcagatacgatttgtttatactacattaggaaaagttgtagctttcaagataaatgt
attcgggttcatttccacttgccatatagatggcaaactttggatggagcccaatggaaa
gatctggccaacatggagaagattgagcaagactattgtgacccatttcatgaaagaatg
gtctacaacggccttgggaatgactccaaggttctagtcattgatttctccaatatgact
tgtaacagtgccaaacttagacgcctctctacagcatcctctgtgactaaagccccatat
tatattctcacaactgattggatctggtattggaaagatgagtgtgatgtctggaatgaa
tatggagtaaaggatcttgaccatgacgctgcgacactgtccagttttgacttggagaag
gcctatcagtccgaagcatcaccaacactcaagttttcagctgggaaacatacatatgaa
cttgatttcagagtcatgaaacagaaaaatctgcgttatcttacagaacgaagtattcgt
agacgaccaaagtttgtgtctccaaaagaagtagaagagaagaaaaaaactggtggagtg
gcacagtcgaaaggaggcacagcattaattccagcacactgggatcaatcagccttgcca
gaattgggatatacgctggttacccttctgtcatcttccaatgaatatagaaaagttcaa
gtcaactttcagcgcacaatgcccaaagcaacaattgtggagatcaagagaatccagaac
cgggctctttgggaagtatatcagtggcaaaaggagcaaatgaaaaaggcaaacgatgga
aaggatgtggatgaaaggcagttgtttcatgggacaaacaagagccatgtcgatgctatc
tgccagcagaactttgactggaggatctgtggcgttcacggaacagcatatggcaaagga
agttactttgcaagggatgcttcatattctgacaattacagtgattctaccaataaaata
atgtttttggccagagttttggtgggagagtttaccataggcatgtcgtcttatcttcgc
cctcctcaaaaagaggtccagagcactggattctataacagttgtgtgaatgatctcagg
aatccatccatctttgtcatttttgagaaacaccagatttaccctgaatatgtgattaaa
tacagaaattag

DBGET integrated database retrieval system