KEGG   Anolis carolinensis (green anole): 100562442Help
Entry
100562442         CDS       T01608                                 

Gene name
ide
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acs01002]
    100562442 (ide)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     100562442 (ide)
Peptidases and inhibitors [BR:acs01002]
 Metallo peptidases
  Family M16: pitrilysin family
   100562442 (ide)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 100562442
NCBI-ProteinID: XP_016851402
Position
Un
AA seq 766 aa AA seqDB search
MAVCVLGRESLDELTSLIVKLFSEVENKNVPLPDFPEHPFQEEHLRQLYKVVPIKDIRNL
YVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKAKGWVNTLVGGQKEGARGFMFF
IINVDLTEEGLLHVEDIILHMFQYIQKLRTEGPQEWVFQECKDLNAVAFRFKDKERPRGY
TSKLAGMLHYYPIEEVLAAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKTFEGKTDKTE
QWYGTQYKQEAISDEVVKKWQNADLNGKFKLPMKNEFIPTNFEIIPLEKDAPQYPTLIKD
TAMSKLWFKQDDKFFLPKACLNFEFFSRYLYADPLHCNMTYLLIRLLKDDLKEYTYAARL
SGLVYAIASGMNAILLSVKGYNDKQHILLKKIVEKMATFEIDEKRFEIIKEAYMRSLNNF
RAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFISQLLSRLHIEALLHGNI
TKQAALGMMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDRGWFVYQQRNEVHNNCGIEI
YYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSE
KPPHYLESRVEAFLKTMEKCVGEMSEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIIS
QQYNFDRDNIEVAFLKTLTKDNIMHFYKDLLAIDAPRRHKVSVHVLAREMDSCPVVGEFP
CQNDVNLAPAPALPQPDVIQNMTEFKRSLPLFPLVKPHINFMAAKL
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctgtgttctaggacgagaatctctagatgagctaaccagtttgatagtaaag
ctattttctgaagtagagaacaaaaatgttccattaccagatttccctgaacatcctttc
caggaggaacatcttcggcaactgtacaaagtggtacctattaaagatattagaaatctt
tacgtcacatttccaataccagaccttcagaagtactataaatctaaccctggccattat
cttgggcatcttattgggcatgaaggtccaggaagtcttttatcagaactgaaagctaaa
ggctgggtaaatacattggttggaggtcaaaaagaaggtgctagaggcttcatgtttttc
atcattaatgttgatcttaccgaagaaggacttttacacgtggaagatatcattttgcac
atgtttcagtatatacaaaagctacgtacggaaggacctcaagaatgggtttttcaagaa
tgcaaggacctaaatgctgtcgccttcaggtttaaagataaggaaagaccgcgaggttat
acatcaaaacttgcagggatgctgcattattatcccattgaagaagttcttgcagctgaa
tatttacttgaagaatttaggcctgacctaatagaaatggtattggataaactgagacct
gaaaatgtccgggttgcaatagtctctaagacttttgaaggaaaaaccgataaaacagag
caatggtatggaacccagtacaaacaagaagcaatttctgatgaagtcgttaagaaatgg
caaaatgctgaccttaatggaaaattcaagctcccaatgaagaatgaatttattcctact
aactttgaaataatacctttagagaaggatgcaccacagtaccctactcttattaaggac
actgctatgagcaaactgtggttcaagcaagatgataaatttttcttacccaaagcttgt
ctcaactttgaatttttcagtcgctacctttatgctgaccctctccattgcaacatgaca
tacctgttaatcaggttattgaaggatgatttaaaagagtatacatatgcagcacgcctc
tcaggtttggtctatgccattgcatcaggaatgaatgcaatacttctatctgtgaagggt
tacaatgacaagcagcatatcctactgaagaagattgttgagaaaatggccacctttgag
attgatgaaaaaagatttgaaattatcaaggaggcgtatatgcgatcacttaacaacttc
cgagctgaacagccccaccagcatgccatgtattaccttcggctattaatgacagaagtt
gcctggaccaaagatgaactaaaagaagccttagatgatgtcactcttccccgcctcaag
gcctttatttctcagctgttgtcacggttacatattgaagcacttctccatggcaatata
acaaaacaggctgcgctaggaatgatgcagatggttgaagacactctcattgagcatgct
cacacaaaacccctgcttcccagtcagctagtacgatacagagaagtgcagctgcctgac
agaggttggttcgtctatcaacagaggaatgaagttcataataattgcggcatagaaata
tattatcaaacagatatgcaaagcacctcagagaatatgtttttggaacttttctgtcag
attatctcagagccttgcttcaataccctgcggactaaggagcagttagggtacattgtg
ttcagtggtccacgaagagctaatggtatccaaggactgcgatttatcatccagtcagaa
aagcctccacactatttggagagcagggttgaagctttcttgaaaaccatggagaaatgt
gtaggagagatgtcagaagaagcatttcaaaagcatatccaggctttagcaattcgtcgc
cttgacaaaccaaagaaactgtctgccgagtgtgcaaaatactggggagaaataatttct
cagcaatataactttgacagagataacattgaagtggcatttctcaaaactcttacaaag
gataacataatgcacttttataaggatttgttggcaatagacgctccaagaaggcataaa
gtatctgtacatgtattagcaagggagatggattcatgtcctgttgtgggagaatttcca
tgccaaaacgatgtaaacctggcaccagcaccagcactgccacagccagacgtgattcag
aatatgacggagttcaaacgcagtctacccctcttccctctggtgaaacctcatatcaat
ttcatggctgcaaaactgtga

DBGET integrated database retrieval system