KEGG   Anolis carolinensis (green anole): 100562756Help
Entry
100562756         CDS       T01608                                 

Definition
(RefSeq) 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00120  Primary bile acid biosynthesis
acs01100  Metabolic pathways
acs03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    100562756
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100562756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:acs00199]
    100562756
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     100562756
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     100562756
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP8 family
   100562756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100562756
NCBI-ProteinID: XP_003221920
Ensembl: ENSACAG00000009156
Position
6
AA seq 512 aa AA seqDB search
MNFWETVLCASLASLLAIILGGLHSMGAFRKRRPKEPPLDKGFIPWLGHGITFKKSPLTF
LEGMQKKHGDIFTCLVGGNYLHFVLDPFIYEALLKESEEKLDFSKSASMIAFNLFGVQPT
QDQHKVAHMNMKHLRGKTLEILNQRLMEKLQHIMLDGKHLRDGERSWQQDGIFHFSYRII
FQATFLTLFGDETGRAALNKEADKESQPMSYGEMFEKFLKFDHLAPQMVIGMLDPQRKEE
TDHLRNIFWDILSVQKISLNENISDWISEQDRQLAEIGMDETMRTKVMFLFFWVSQVNTG
PAIFWILTYLLKHPEAMEAVRDEVDRALKGTGEEVKPGSPFIKATLATIKTPLLDSAILE
TLRLRASPFMFRTVVQDTDIRMADGREYLVRKGDALLLFPFLAIHMDPEIHPDPHAFKFD
RFVSPNGTRKEFYKDGKTLKHSILPFGAGHTKCPGRFLAVNEMKIFVFLMLIYFDIELVN
PEEGIPSVEGSSYGFGTVKPSHDIQFKYRLRF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctgggagacggtgctttgtgcttccttagcctccctcttggccatcatcctc
ggtgggctccattcaatgggggcatttcgcaagagaagacccaaagaacctccactggac
aaaggcttcattccttggcttgggcatgggataaccttcaagaaaagcccccttactttt
ttggaagggatgcaaaagaagcatggagatattttcacatgtctggtgggcggtaactac
ctccacttcgtgctcgatcctttcatatatgaagccctgttgaaggaatcggaagagaaa
ctcgattttagtaagtctgcctccatgattgctttcaacctgtttggggtccagccaacg
caagaccagcacaaggttgcccacatgaacatgaagcatctccgcggtaagactctggag
atcctgaaccagaggttgatggagaagctgcagcacatcatgctcgatggaaaacatctg
agagacggggaaagatcttggcaacaagatgggatctttcacttcagctacagaatcatc
ttccaagcgacgtttctgaccttgtttggagatgagacaggcagggctgcgttgaacaag
gaagccgacaaagagagccaacccatgtcctatggagagatgtttgaaaagttcttgaaa
ttcgaccacttggccccccaaatggtcattggcatgttggatccccagcgcaaggaggaa
acagaccatctgaggaacatcttctgggacattctgtcagtccaaaagatctccctgaat
gagaacatcagcgactggatatctgaacaggatcgccagctcgctgagataggaatggat
gaaaccatgaggacaaaagtcatgtttctgtttttctgggtgtctcaagtgaataccggt
ccagccattttctggattcttacgtatctcttgaaacatccagaagcgatggaagcagtg
agggacgaagtggacagagcattaaaagggactggtgaggaggtcaagccaggtagtcct
ttcatcaaggcgactttggctacgataaagactcctcttctggacagtgcgatactggaa
actctgcgcttaagagcaagtccttttatgttccgaaccgtggtgcaagacacagatatt
aggatggcggatggaagggagtatctggtgcggaaaggagacgctctgctccttttcccc
ttcctcgccattcatatggatccagaaatccaccctgatcctcacgccttcaagtttgac
aggtttgtgagcccaaatggcaccaggaaagaattctataaggatgggaaaaccctgaag
cactccattttgccctttggggctggacacaccaagtgtcccggccgattcttggctgtt
aatgaaatgaagatctttgtcttcttgatgctcatctactttgacatcgaattggttaat
ccagaagaaggaataccttctgtagaaggaagcagttatgggtttgggactgttaagcct
tcccatgacattcagttcaagtatcgactgagattctaa

DBGET integrated database retrieval system