KEGG   Anolis carolinensis (green anole): 100563424Help
Entry
100563424         CDS       T01608                                 

Gene name
nfxl1
Definition
(RefSeq) nuclear transcription factor, X-box binding like 1
  KO
K15683  NF-X1-type zinc finger protein NFXL1
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acs04121]
    100563424 (nfxl1)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   NFX1 proteins
    100563424 (nfxl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-NF-X1
Motif
Other DBs
NCBI-GeneID: 100563424
NCBI-ProteinID: XP_003225362
Ensembl: ENSACAG00000006640
UniProt: H9GBQ7
Position
Un
AA seq 886 aa AA seqDB search
MEAAGAWRQGGRGRGSNRAASAGMGSRPGGRGRARGTGVAVWNSGGSGPGASELASQKKF
DEIKKANQAAAKKFVEEQFSSSSEEDEEEIEGKHGRILDKTFTTYTVQAGGDASELERTR
QYMNDAFQSGAMTCLICIASIKRNQAVWSCYGCFCIFHMPCIQKWAKDSLFLISSPLTDD
DFGKKDHPWPCPKCRFEYKRSQTPSRYYCYCGKVEDPPLDPWLVPHSCGQVCERDFKPPC
GHKCLLLCHPGPCPPCPKMVTVTCYCKKAKAVPRRCSTKEWSCQLPCGRRLPCGQHNCEK
ACHPGDCQPCPRISKQRCVCGRQVAERLCASPLWQCDQVCGKTLPCSYHVCEEICHGGPC
GECPRSGKRSCPCGKSKFSLPCTEDVPTCGDSCNKVLECGIHRCSQRCHRGPCEICRQEV
EKQCRCGKHTRQMPCHKPYLCETKCAKIRDCQKHQCKRKCCPGNCPACDQVCGRTLGCRN
HKCPSVCHRGSCYPCPETVDVKCNCGKTVIKVPCGRERTTKPPRCKELCRHPPTCHHPSR
EKHSCHFGPCPLCRQPCRKTLEKCSHLCPALCHDEALVKQTGLHQPAGPWEQTAEPAFIQ
TALPCPPCLVPVPMQCLGKHEMSPLPCHAVGPYSCKRVCGRLLDCQNHTCMKECHKVTET
DSNNDGQKAGPECFQCEEECSKPRPPGCPHSCPLPCHPGECPSCAQMIRMKCHCKLSSLY
IECIKITSADLKEKEELSSCKNQCPKELSCGHRCKEICHPGDCPQNCNQKVKVRCPCKRL
KKEMLCSKLREGQVSLECDAVCQEVKQKAFELKEAETRAAIEEEKRRQQAELEAYENRLK
GRRKNKRKRDEVEVEKSVWQKYKNMIVLPIFGAAVVMVAWFIAYND
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcaggggcttggcggcagggcggccgaggcaggggcagcaacagggcggcc
tcggcggggatggggagccgacccggcggccgaggaagggcccgagggaccggagtagcg
gtttggaatagcggcggcagcggccctggagctagcgaattggcatcacagaagaaattt
gatgagatcaagaaggccaatcaagctgcggctaaaaagtttgtggaagagcagtttagt
tcctcctctgaagaagatgaagaagagattgaaggaaaacacggaagaatattggacaaa
acatttacaacttacactgttcaagccggtggagatgcaagcgaattggagcgtacaaga
cagtacatgaatgatgctttccagtctggggcgatgacatgcttgatttgcattgcttca
attaagagaaaccaagctgtttggagttgctatggatgtttttgcatatttcacatgcct
tgcattcagaagtgggcaaaggatagccttttcttaatatcctctcctttgacagatgat
gattttggaaaaaaggatcatccatggccatgtccaaaatgcaggtttgagtacaagcgt
tctcagacgccctctcgatactactgctactgtggaaaggtggaagatccaccattagat
ccctggctggttccacattcctgtggccaagtatgcgagagagatttcaaacctccctgt
ggacacaagtgcctgttactatgtcacccaggtccttgtccaccttgtccaaagatggtg
acagtaacgtgttactgcaagaaagccaaagctgtgccgcggagatgcagcacaaaggaa
tggtcatgtcagctgccttgtggacggaggttgccgtgtggacaacacaactgtgaaaaa
gcttgtcatccaggagactgtcaaccctgcccgagaattagtaagcaaaggtgtgtctgt
ggtagacaggtagcagaaagactttgtgcaagccctttatggcagtgtgatcaggtttgt
ggtaaaacattgccttgcagctatcatgtctgtgaagagatttgtcatggtggcccttgt
ggggaatgtcctcgttccggcaaaaggtcttgtccatgtggaaaatccaaattttctttg
ccgtgtacagaggatgtgcctacttgtggtgacagttgcaacaaagttcttgaatgtggc
attcatcgatgttcacagcgctgccaccgaggcccctgtgaaatctgtaggcaggaagtt
gagaagcagtgccgttgtggaaagcatacaaggcagatgccctgccataagccatatctt
tgtgaaacaaaatgtgcaaaaattcgtgactgtcaaaaacaccagtgcaagaggaagtgc
tgccctggaaactgcccagcatgtgatcaggtttgtggaagaactctggggtgtcggaat
cacaagtgtccttcagtctgccacagaggtagctgctatccatgtcctgaaactgtagat
gtgaagtgcaattgtggcaaaactgttatcaaagtaccttgtgggagagaacgtaccact
aaaccccccaggtgcaaagaactatgcaggcatccacctacttgccatcatcctagccgg
gagaagcacagttgccacttcgggccttgtcctctttgccggcagccctgcaggaaaacc
ttagaaaagtgtagtcacctgtgccctgctctttgtcatgatgaagcactggtgaagcaa
actggcctgcatcagcctgctgggccttgggagcagacagctgaacctgcttttattcag
acagcattaccatgtcctccatgtctagttcctgttccaatgcaatgccttgggaaacat
gagatgagtccactgccatgtcatgctgtgggaccctactcttgtaaaagagtttgtgga
agattgcttgattgtcagaaccacacttgcatgaaagaatgccataaagttactgaaaca
gatagtaacaatgatggccaaaaggcaggtccagagtgttttcagtgtgaagaagaatgt
tccaagccacggccacctggatgccctcactcttgccctttgccttgccatcctggagaa
tgcccatcatgtgcccagatgattcggatgaagtgccattgcaaactatcaagtctttac
attgaatgcataaaaatcacttctgcagacctaaaggaaaaggaggaactgagttcctgt
aaaaatcagtgtccaaaagagctatcctgtggtcatcgatgtaaagaaatttgccatcca
ggtgactgtcctcagaactgcaaccaaaaggtcaaggtccgctgtccttgcaaaaggctc
aaaaaggaaatgctgtgtagcaagcttcgagaaggccaggtttcattagaatgtgatgca
gtatgccaggaagtgaaacagaaagcttttgagttgaaagaagcagaaaccagagctgcc
attgaagaggaaaaaagaaggcaacaggctgaattggaggcttatgagaacaggctaaaa
gggcgccggaaaaacaagagaaaaagagatgaggttgaagttgaaaaatctgtatggcaa
aaatataagaatatgattgtactgccaatatttggggctgccgttgtaatggttgcatgg
ttcattgcctacaatgattga

DBGET integrated database retrieval system