KEGG   Anolis carolinensis (green anole): 100563543Help
Entry
100563543         CDS       T01608                                 

Gene name
slc4a1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acs02000]
    100563543 (slc4a1)
   04147 Exosome [BR:acs04147]
    100563543 (slc4a1)
   04090 CD molecules [BR:acs04090]
    100563543 (slc4a1)
Transporters [BR:acs02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100563543 (slc4a1)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100563543 (slc4a1)
CD molecules [BR:acs04090]
 Proteins
  100563543 (slc4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto MFS_MOT1
Motif
Other DBs
NCBI-GeneID: 100563543
NCBI-ProteinID: XP_008111477
Ensembl: ENSACAG00000017228
Position
6
AA seq 939 aa AA seqDB search
MAAQSEEDYEAGFQKNLDVDAYDDSVLKSSNMSLASEKSGSSAGEEPGSAKATKRPYTVH
RASHEAYVELHELIMDRNNECRWLEASHWIKIEEDFEELGHWGRPHLSYLTFQSLMEVRR
AFTKGTVLLDLPERSLAGIANQVLDQMIYEGQLKPEDREMVLRTLLLQHSHPDASTSLSN
VSPARLQRSETKDVTQPLLAEHQQIEMKSFLPDPEQGEPSSTAFKKPLSEKISPDAEATL
VLVGCATFLERPTLAFVRLKDAVELDSVLEVPVPVRFLFVVLGPDSPHTSYHEIGRAIST
MMSERVFRNDSYLAEGRTDLVKSMETFLDCCIVLPPSDIQSEKLLKTLLPVQKELLRKRY
QPMEKKVSPETELLGDLEKELKAHARKKVDDDDDDDPLRRTKIPFGGLVRDIKRRYPKYL
SDIKDALNAQCLAAVIFIYFAALSPAITFGGLLDDKTRSMMGVSELLLSTAVQSVMFCLL
GAQPLLVLGFSGPLLVFEEAFYKFCDDNGFEYIVGRVWIGYWLIILVVIIVACEGSFLVR
YISRYTQEIFSFLISLIFIVETFVKLIKIFQEHPVKQEYINITAINSKGEPAAPQPNTAL
LSLVLMAGTFFIAFFLRKFKNSSFLPGKLRRVIGDFGVPIAIFIMAMADFFIEDTYTQKL
KVPKGLEVSNPNQRGWFIHPLGFQNSFPILMMFAAALPALLVFILIFLESQITTLIVSKP
ERKLVKGSGFHLDLLLIVGMGGVAAMFGMPWLSATTVRTVTHVNALTVMSKTTVPGEKAH
VQEVKEQRITGLLVGILVGLSILMEPVLKLIPLAVLFGIFLYMGVTSLNGVQLYDRILLM
LKPPKYHPDEAFVRKVKTWRMHMFTLTQIACLVVLWGVKSSPASLALPFLLILTVPLRRF
ALPIFFTDTELKCLDCDDADVTFDETEGQDVYDEVQMPV
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcagagtgaggaggactacgaagctggttttcaaaagaacctggatgttgat
gcatatgatgactctgtattgaaaagttccaacatgtcgcttgcaagtgaaaaaagtggc
tcctcagctggagaagagccagggagtgcaaaggctaccaaacggccatacactgtccac
agagcatcccatgaggcatatgtggaacttcacgaactgatcatggaccggaacaatgag
tgtcgctggctggaggcatctcactggatcaaaatagaggaggactttgaggagctgggg
cattggggtagacctcacctctcgtacctgactttccaaagccttatggaggtgcgccgg
gctttcaccaaaggaactgtccttttagacttgcctgaaagaagtctagctgggattgcc
aaccaggtgcttgaccaaatgatctacgaaggacagctcaagccagaagaccgagaaatg
gtgttgagaaccctcttgctccaacacagccaccccgatgcatccacttcattaagcaat
gtttcccctgcacggctgcagcgatctgaaaccaaagatgtaacacagcccctcctggca
gaacatcagcaaattgagatgaagagctttcttcctgatccagagcagggtgagcccagt
agcactgcttttaagaagccactttcagagaagatttcccctgatgcagaagccacactg
gttttggttggctgtgccaccttcttggagcgcccaactttggccttcgtacgcttgaaa
gatgctgtggagctggactctgtcctggaagtccctgtgcctgtcaggttcctctttgta
gtgctgggcccggattcccctcataccagctaccatgagattgggagagccatctcaaca
atgatgtccgaaagggtgtttcgcaatgattcctacttggctgagggaaggacagacctt
gtgaaaagcatggagacgttcctggactgttgcattgtcctccctcctagtgacatccaa
agtgaaaaactcctcaagacattgctgcctgtgcagaaggagctcctacggaagaggtac
cagccgatggagaagaaggtgtcgccagagactgaactcttgggagacttagaaaaagaa
ctgaaagcccatgcccggaaaaaagttgatgatgatgatgatgatgaccctttgcgtagg
accaagataccttttggaggactggtgagggacataaaacggcgataccccaagtatctt
agtgacatcaaggatgcccttaatgcccagtgtctggctgcagttatcttcatctacttt
gctgccctttctcctgccattacttttgggggccttctggatgacaagactaggagcatg
atgggagtatccgagctccttctctccactgcagtccaaagcgtaatgttctgtttgctt
ggagctcagcctttgcttgtgcttggattttctggtccccttttggtctttgaagaagcc
ttttataagttttgcgatgataatgggtttgaatatatcgtggggagagtctggattggc
tattggctcataatcctggtggtgatcatcgtggcttgtgagggcagcttcctggtgcgc
tacatctcccgttacacccaggagatcttctccttcctcatctctctcatcttcattgtg
gagactttcgtcaaacttatcaagattttccaggaacatcctgtgaaacaagaatatata
aacatcactgctatcaactcaaaaggggaacccgcagccccccaacccaacacggctctg
ctctcccttgtcctcatggcgggaacatttttcatcgctttcttcttgcgcaagttcaaa
aacagcagtttccttccaggaaagctccgccgtgtgattggggactttggtgtccctatt
gccatctttatcatggccatggcagacttctttattgaggacacctacactcagaaactg
aaagttccaaaaggccttgaggtctccaatccaaatcagcgaggttggtttatccatcca
ctgggattccaaaatagtttccccattctgatgatgtttgctgcagctttaccagctctt
ttggtcttcatcctcatcttcttggaatcacagattaccacattgattgtgagcaaacca
gagagaaaacttgtgaaaggttcgggtttccatctagacctgcttctgattgttggcatg
gggggtgtagcagccatgtttggcatgccctggctcagcgccaccactgtgagaaccgtc
acgcatgttaatgccctgacagtgatgtccaagactactgtcccaggggaaaaggctcat
gttcaagaggtcaaggaacagaggatcaccggcttgctggtgggcattcttgtaggcctc
tccatcctcatggaacccgtcttgaaattgattccacttgcagtactctttggcattttc
ctttacatgggggtgacatccctcaatggggtccagctgtatgatcgcatccttctaatg
ctgaagccccccaaataccaccctgatgaagcttttgttagaaaggtaaagacctggcgc
atgcatatgttcaccctcacccagatagcatgtctggtggtgctgtggggagtgaaatcc
agcccagcgtccttggctctgcctttccttctcatcctgactgtgccattaagacgcttt
gcactccccatcttcttcactgacactgaactcaagtgtttggattgtgatgatgctgat
gtgacctttgatgagacagaaggccaagatgtttatgatgaagtccagatgccagtttga

DBGET integrated database retrieval system