KEGG   Anolis carolinensis (green anole): 100563767Help
Entry
100563767         CDS       T01608                                 

Gene name
dpagt1
Definition
(RefSeq) dolichyl-phosphate N-acetylglucosaminephosphotransferase 1
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00510  N-Glycan biosynthesis
acs01100  Metabolic pathways
Module
acs_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100563767 (dpagt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:acs01003]
    100563767 (dpagt1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     100563767 (dpagt1)
Glycosyltransferases [BR:acs01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   100563767 (dpagt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 100563767
NCBI-ProteinID: XP_003230162
Ensembl: ENSACAG00000015612
UniProt: H9GMJ6
Position
Un
AA seq 406 aa AA seqDB search
MWKLPLIPLLINFLGSLVGFVATLTLIPAFKDHFIAAKLFGLDLNKTSKQPVPESQGVIS
GAVFLIILFCFIPVPFLSCLVEEQCKAFPHHEFVALIGALLAICCMIFLGFADDVLNLRW
RHKLLLPTMASLPLLMVYFTNFGNTTIVVPKPFRMFLGMHLDLGILYYVYMGMLAVFCTN
AINILAGINGLEAGQSLVIAASIVTFNMVELSGDYRDDHIFSLYFMMPFFFTTLGLLYHN
WYPSRAFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLLHIVPCPRH
RLPRFNPDTGKLEMSYSRFKPKSLSPLGKHILKVSEKLRLVDIRQGVDKDGEYLECNNMT
LINFVIKLIGPTAERNLTVLLLLMQVVGSVVAFSVRYQLVRLFYDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagctgccgctgattccgctgctcatcaacttcctgggctccctggtgggcttc
gtggccaccctgaccctcatcccggccttcaaggaccacttcattgccgccaagctcttc
ggcctcgacttgaacaagacctcgaagcagcccgtcccagagtcccaaggcgtcatcagc
ggcgccgtgttcctcatcatcctcttctgcttcatcccggtgcccttcctgagctgcttg
gtggaggagcagtgcaaggccttcccgcaccatgagtttgtggccctcatcggggccctc
ctggccatctgctgcatgatcttcctgggcttcgcggacgacgtgctcaacctgcgctgg
cgtcacaagctgctcctgcccaccatggcctccctgcccctcctcatggtctatttcacc
aacttcggcaacaccaccatcgtggtgcccaagcccttccggatgtttctgggcatgcac
ctggacctgggcatcctctactacgtctacatgggcatgctggccgtcttctgcaccaac
gccatcaacatcctggctgggattaatggcctggaggccgggcagtcgctggtcatcgcg
gcctcgattgtcacgttcaacatggtcgagctcagcggggattacagggacgaccacatc
ttctccctctacttcatgatgccctttttcttcaccacgttggggctgctctaccacaac
tggtacccatcccgggcctttgtgggcgacaccttctgctactttgcgggcatgaccttt
gccgtggtgggcatcctgggccacttcagcaagaccatgctgctcttcttcatcccgcaa
gtgctcaacttcctctactcgctgccgcagctcctccacatcgtcccttgcccacgccac
cggttgcccaggttcaaccctgacacaggaaagctagagatgagctattccagattcaag
ccaaaaagcctctctcctttgggaaagcacatcctcaaggtctctgagaaactccgcctg
gtcgacatacgccagggagtggacaaagacggggaatacctggaatgcaacaacatgacg
ctcattaacttcgtgatcaagctaatcgggccgacggcagaaagaaacctgacggtgctg
ctgttgctgatgcaggtggtggggagcgtcgtcgccttctccgtccggtaccaactggtg
cggctgttctacgacgtctga

DBGET integrated database retrieval system