KEGG   Anolis carolinensis (green anole): 100564394Help
Entry
100564394         CDS       T01608                                 

Gene name
blvra
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00860  Porphyrin and chlorophyll metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100564394 (blvra)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     100564394 (blvra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 100564394
NCBI-ProteinID: XP_003222261
Ensembl: ENSACAG00000017470
Position
6
AA seq 297 aa AA seqDB search
MMSGTVVIGIGIAGSLRIRDLLNPLPSSPVEHLKLLGFVSRRSLGNVQGVKQISLQEALN
SNEVNVAIISTDNQNHSESVRMFLEAGKHVLVEYPMSLSAKTAHELWGLAEQKGKILHVE
HIELLTEEYKQLKKEVEGKELVKGTLHFTGGPLDEERSGFPAFSGIARLSWLVDLFGDLT
VTSATREEQKEKNYSRMTAHFLTADKRPLTWIEERAPGMKRDKIINFCFKSGCLERLPDA
PRSAVGIFMQDLILFAKKLLGQISKEELAAEKRRILLCLELAEEIKMHCEQPQNIYS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgggaccgtggtaattggaattggaattgcaggatctttgcggatcagagac
ttgctgaatcctttgccgtccagtcctgtcgaacacctgaaactgctgggctttgtgtct
aggcgatctcttggcaatgttcaaggagtgaaacaaataagtcttcaagaagctctgaac
agtaatgaagtcaatgtggccatcatcagtacagataaccaaaaccacagtgaaagtgtc
aggatgtttctagaagctgggaaacatgtccttgttgaatatcccatgtcattgtctgca
aagacggcacatgagctctggggattagctgagcaaaaaggtaaaatccttcatgtggag
catattgagttactgacagaggaatacaaacaattaaagaaagaggtggaagggaaggaa
cttgtcaagggaacattacatttcacaggtggtccactggatgaagagcgttcaggcttt
ccagcttttagtggaattgcccgcctcagttggctggtcgacctttttggagacctcaca
gtcacttctgccacaagggaagagcagaaagaaaaaaattactccagaatgaccgcacat
tttctgactgcagataagaggcctctgacttggattgaagaaagggcaccagggatgaaa
cgggataagatcataaacttctgtttcaaaagtgggtgcttggagaggcttccagatgcc
ccccgttcagctgttggcatcttcatgcaagacctgatcctgtttgccaaaaagttgctg
ggccagatttctaaggaggaactggctgctgaaaagagacgaattctgctgtgtcttgag
cttgccgaagagattaaaatgcactgtgagcagccacaaaacatctactcttga

DBGET integrated database retrieval system