KEGG   Anolis carolinensis (green anole): 100564422
Entry
100564422         CDS       T01608                                 

Gene name
dmwd
Definition
(RefSeq) dystrophia myotonica, WD repeat containing
  KO
K24731  dystrophia myotonica WD repeat-containing protein
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:acs04990]
    100564422 (dmwd)
Domain-containing proteins not elsewhere classified [BR:acs04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   100564422 (dmwd)
SSDB
Motif
Pfam: WD40 PD40 Ge1_WD40
Other DBs
NCBI-GeneID: 100564422
NCBI-ProteinID: XP_008121856
Ensembl: ENSACAG00000004089
UniProt: H9G8I1
Position
Un
AA seq 647 aa
MAAALAPPAQDGGPTPTPPPQQQQPPYEVKSQFRTREGSYRLLGAPEPRTRPAGAATPSS
SAAPPPPPPPPSSASGGAPPPPPPPAPSLPPVRLSLVRLNSSSGGGGGGGGDPGGEGDPG
ALAAERSRVCFNLGRELYFYSGSGGAPGRGRRSIDLKKPIDKRIYKGTQPTCHDFNQFTA
ASETISLLVGFSAGQVQYLDLIKKDTTKLFNEERLIDKTKVTYVKWIPETESLFLASHAS
GHLYLYNVEHPCGSASPQYTLLKQGEGFTVYGCKSKSARNPLLKWAVGEGALNEFAFSPD
GRYLACVSQDGCLRVFHFDSMLLQGMMKSYFGGLLCVCWSPDGRYIVTGGEDDLVTVWSF
AEGRVIARGHGHKSWVNAVAFDPFTTSTEDDGSGEFSGSDEDIQETSNFGRVRTSSTLSH
LSKHSTKSTPSVTYRFGSAGQDTQFCLWDLTEDVLYPHHPLSRARTLTNTFSAGIPPSGS
GGSNLAAESTGGGALPRSLSRSNSLPHPAVTSAAKSHVADGVVPFSIGKFATLTLQERKE
KNAEKEHKRYHSLGNISKSNDKLNVVPKSKLDTAKVLGTALCPRINEVPLLEPLICKKIA
HERLTVLLFLEDCIITACQEGLICTWARPGKATLNSQNGGSPSGTVV
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggcggcggcgctggctcctccggcccaggacggaggcccgacgccgacgccgccgcct
cagcagcagcagccgccctacgaggtgaagagccagttccggaccagggagggctcctac
cggctgctgggggcgcctgagccaaggaccaggcccgccggagcagccaccccttcttcc
tccgcagccccgccgccgcctccgccgccgccgtcttccgcctcgggaggagccccgccg
ccgccgcctccgcccgccccgtcgctgcctccggtccgcctctccctggtgcgactgaat
tcttccagcggaggaggaggaggaggaggaggggaccccggcggggagggcgaccccggg
gccctggccgccgaaaggagccgcgtctgcttcaacctgggcagggagctctacttctac
tccgggtccggaggtgcgcctgggaggggacgccggtccattgacctaaagaaacccatt
gacaagcggatctataaggggacgcagcctacttgccatgacttcaaccagttcacagct
gcatcagaaactatctcgctgctggttggcttctcagctgggcaggtgcagtacctggat
cttatcaagaaagataccactaaactattcaatgaagagcgactgattgacaagaccaag
gtcacctatgtgaagtggatccctgagaccgagagccttttcctggcctcccacgccagt
ggccacttgtacctatacaacgtggagcacccctgtggctcagcctcaccccagtacacc
ctccttaaacaaggcgaggggttcacagtctatggttgcaaaagcaagagtgctcgcaac
ccactcctgaagtgggcagtcggtgaaggagccctcaacgaatttgccttctcccccgac
gggcgctacctggcttgcgtcagccaagacggctgcctccgtgtcttccattttgactcc
atgctcctgcaggggatgatgaagagctactttgggggcctgctgtgcgtctgttggagc
cccgatgggcgctacatcgtgacggggggcgaggacgacttggtaacagtctggtccttt
gctgagggccgggtcattgccaggggccacggccacaagtcgtgggtcaatgctgtggct
tttgatcccttcaccaccagtacggaggatgacgggagtggggagttcagcgggagcgat
gaggacatccaagagacatccaattttggcagggtaaggacaagcagcactctctcccac
ctttcaaagcatagcaccaaaagtacgccctcggtgacttaccgctttggctctgctggc
caggacacccagttctgcctttgggatctgacggaagacgtcttgtaccctcatcaccca
ctctcccgagctcgaacgctcaccaacaccttcagcgctggcatccccccttccgggagt
ggtgggagcaacctggctgctgaatccactggcggaggggccctccctcgctcactgtcc
cgctccaacagcttgccccacccagccgtcaccagcgccgccaagagccacgtggctgac
ggggtggtgcctttcagcatcgggaagttcgccaccctgaccttgcaggagcggaaggag
aagaacgcagagaaagagcacaagcgctaccacagcttgggcaacatcagcaagagcaac
gacaagctcaacgtggtgcccaaaagcaagctggataccgccaaggtcttgggcactgcc
ctgtgcccccgcatcaacgaagtgcccctcctcgagcccctcatttgcaagaagattgcc
cacgaacggctgactgtcttgcttttcctagaggactgtatcattaccgcttgccaggag
ggcctcatctgcacctgggccaggccggggaaagcgactctgaactctcagaacggcggc
tccccgagcggcacagtggtataa

DBGET integrated database retrieval system